(data stored in ACNUC7421 zone)

EMBL: CP001630.PE158

CP001630.PE158       Location/Qualifiers
FT   CDS             176495..177745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0161"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: ADR019Cp; K01066 esterase / lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34132"
FT                   /db_xref="GOA:C6WDY7"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY7"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34132.1"
FT                   /translation="MASRLLKRAGAIALGASIALTTAALPASATAIEILPIPRHDPDFA
FT                   KFHEEGIEVKMSGHKDKDNWLGANLIALKVKEDGKTTGVKAYCVELPTPLENGTPLTEV
FT                   PWGEHPNSGTKFKENADKINWILQNSYPVKDASVLSEATGKSVSKREAIAATQAAIWHF
FT                   SDGADLDTTKDRDRQTNEDVKAVYAYLIGEKNVGIKEQPAPSLAITPKTQSGKPGDLIG
FT                   PFEVSTTAGAVVLKADLPQGVTLVDAAGATLKTAAKGDASASADTKFEKVFVKVPEGAK
FT                   DGQVSFSLQADAKLNSGRLFVSSDKNKKTQSLVVALPSQVTVKAEATASWKAEQVTTPP
FT                   TTTSVSTSPSAPAPSSSNPSTPESSTPETSVSPVPVAEKDELASTGASIFVPLLIGLGL
FT                   LGAGAAAMIVMRRRKTA"
     MASRLLKRAG AIALGASIAL TTAALPASAT AIEILPIPRH DPDFAKFHEE GIEVKMSGHK        60
     DKDNWLGANL IALKVKEDGK TTGVKAYCVE LPTPLENGTP LTEVPWGEHP NSGTKFKENA       120
     DKINWILQNS YPVKDASVLS EATGKSVSKR EAIAATQAAI WHFSDGADLD TTKDRDRQTN       180
     EDVKAVYAYL IGEKNVGIKE QPAPSLAITP KTQSGKPGDL IGPFEVSTTA GAVVLKADLP       240
     QGVTLVDAAG ATLKTAAKGD ASASADTKFE KVFVKVPEGA KDGQVSFSLQ ADAKLNSGRL       300
     FVSSDKNKKT QSLVVALPSQ VTVKAEATAS WKAEQVTTPP TTTSVSTSPS APAPSSSNPS       360
     TPESSTPETS VSPVPVAEKD ELASTGASIF VPLLIGLGLL GAGAAAMIVM RRRKTA           416
//

If you have problems or comments...

PBIL Back to PBIL home page