(data stored in ACNUC7421 zone)

EMBL: CP001630.PE16

CP001630.PE16        Location/Qualifiers
FT   CDS             complement(17118..17384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0016"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33990"
FT                   /db_xref="GOA:C6WCG9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU33990.1"
FT                   /translation="MPKSKVRKKAVYTAPADRRTPVKVKAAGPSHPFYITVMLGVMLLG
FT                   LAWLVVNYIAGEKIPVMMDLGSWNFGIGFSLIIVGLLMTMRWR"
     MPKSKVRKKA VYTAPADRRT PVKVKAAGPS HPFYITVMLG VMLLGLAWLV VNYIAGEKIP        60
     VMMDLGSWNF GIGFSLIIVG LLMTMRWR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page