(data stored in ACNUC7421 zone)

EMBL: CP001630.PE160

CP001630.PE160       Location/Qualifiers
FT   CDS             178054..178677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0163"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   sme:SMc03980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34134"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY9"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ACU34134.1"
FT                   /translation="MSTARTAERATAQQGESRAAARMVTWQGCSVPRLEQVRVLVSEHK
FT                   LRASGRIVASGPAEQFNGSFELSVGEDGAVTRLLLRTATVAEERHVSLSRSSDGVWMVD
FT                   RGHGGERADFDGAVDVDVEFAVLFAAIPVRRLGLHREPGEAELPVVRVSLPDLDVTVVR
FT                   RGYRTASVGDGGSVVAIRAEDGEQDVTVDAEGLVVDYPDVAQRI"
     MSTARTAERA TAQQGESRAA ARMVTWQGCS VPRLEQVRVL VSEHKLRASG RIVASGPAEQ        60
     FNGSFELSVG EDGAVTRLLL RTATVAEERH VSLSRSSDGV WMVDRGHGGE RADFDGAVDV       120
     DVEFAVLFAA IPVRRLGLHR EPGEAELPVV RVSLPDLDVT VVRRGYRTAS VGDGGSVVAI       180
     RAEDGEQDVT VDAEGLVVDY PDVAQRI                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page