(data stored in ACNUC7421 zone)

EMBL: CP001630.PE161

CP001630.PE161       Location/Qualifiers
FT   CDS             complement(178764..179948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0164"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: gbm:Gbem_1434 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34135"
FT                   /db_xref="GOA:C6WDZ0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACU34135.1"
FT                   /translation="MQRPLILDAARTPFGRYRGGLSGVRVDDLAALPISELLRRHPDLD
FT                   PARVDDVLYGNTNGAGEENRNIGRMAALLAGLPPTVPGASVNRLCASGGEAIVQASRAL
FT                   AMGDADVVVAGGVEGMTRAPFVVPRPDRPFADRLEPVSTALGWRLVNPRMPSAWTVPLG
FT                   RAAEQVAAELGITRERMDQYALRSHRRASAAWDAGVHDGFAFPVQLPDGSAVRRDESVR
FT                   PETSAEKLAKLKPAFSDDGTVTAGNSSPLNDGAAAVLLGTESLATELGVTPLGEVLGSA
FT                   VTAGEPQRFTLAPVGAIRKLLGRLGIGGADVDLWEINEAFAAMALSVLHHLPEVDREKV
FT                   NVHGGAIAYGHPLGASMPRVVVDLCRHLRARGGGVGVAAACVGVGQGMAIAVRV"
     MQRPLILDAA RTPFGRYRGG LSGVRVDDLA ALPISELLRR HPDLDPARVD DVLYGNTNGA        60
     GEENRNIGRM AALLAGLPPT VPGASVNRLC ASGGEAIVQA SRALAMGDAD VVVAGGVEGM       120
     TRAPFVVPRP DRPFADRLEP VSTALGWRLV NPRMPSAWTV PLGRAAEQVA AELGITRERM       180
     DQYALRSHRR ASAAWDAGVH DGFAFPVQLP DGSAVRRDES VRPETSAEKL AKLKPAFSDD       240
     GTVTAGNSSP LNDGAAAVLL GTESLATELG VTPLGEVLGS AVTAGEPQRF TLAPVGAIRK       300
     LLGRLGIGGA DVDLWEINEA FAAMALSVLH HLPEVDREKV NVHGGAIAYG HPLGASMPRV       360
     VVDLCRHLRA RGGGVGVAAA CVGVGQGMAI AVRV                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page