(data stored in ACNUC7421 zone)

EMBL: CP001630.PE162

CP001630.PE162       Location/Qualifiers
FT   CDS             complement(179961..181772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34136"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34136.1"
FT                   /translation="MDRRRIGFFAAGAVLFAGVVVVLRGGGAPGPADAGITTQPPPPTS
FT                   LTAFASDGVLAPSPGSVPDPPEGLEAAPGPGSLVVTWTGGAPGYEVRWGLGDVSRTRLV
FT                   TGSLVELRLADGLEQRVEVRAVDGFGQRSAPASVSGAPGPVGVSEPGAYHLVDRFEGAS
FT                   APDPARWRLTARPGCARAGAGSDEEAAALVVATTCAGVPAVLRSRAPLVLREDGEELGR
FT                   FAVGAGAPIANGELALELAPGPVAALSGAEPPPGALRLLVRATEDSVTARVLTAEGDRT
FT                   RELRPLDGVAPGTGHVWELVLRRDGALVLLDGEPVATSPVVPAWREATALISVSGPIGQ
FT                   RVPVWLAGLGGAPSTAPPLVGPVRVEVTPQGGEAGSGVGAPAGQLRLTVSHTLSRERDA
FT                   PLVALVSGVPVPLRRAVDGAPVRADTGLPLVGDVPAGVASVSPDGVVGVRLDLGFDATA
FT                   THAELELGPGGAVPVAANPEPGPPQSALPRPSARVLDASGRPLPPGTPVPRGRVVVEVE
FT                   LVGAPAQHGLAGLAGFGLWLDGTRIASVPTAVGGPAVAGTYRVAVNTGALPGGPLSEGP
FT                   HMVEARLFGTSGSTRPTSAFASFFAAR"
     MDRRRIGFFA AGAVLFAGVV VVLRGGGAPG PADAGITTQP PPPTSLTAFA SDGVLAPSPG        60
     SVPDPPEGLE AAPGPGSLVV TWTGGAPGYE VRWGLGDVSR TRLVTGSLVE LRLADGLEQR       120
     VEVRAVDGFG QRSAPASVSG APGPVGVSEP GAYHLVDRFE GASAPDPARW RLTARPGCAR       180
     AGAGSDEEAA ALVVATTCAG VPAVLRSRAP LVLREDGEEL GRFAVGAGAP IANGELALEL       240
     APGPVAALSG AEPPPGALRL LVRATEDSVT ARVLTAEGDR TRELRPLDGV APGTGHVWEL       300
     VLRRDGALVL LDGEPVATSP VVPAWREATA LISVSGPIGQ RVPVWLAGLG GAPSTAPPLV       360
     GPVRVEVTPQ GGEAGSGVGA PAGQLRLTVS HTLSRERDAP LVALVSGVPV PLRRAVDGAP       420
     VRADTGLPLV GDVPAGVASV SPDGVVGVRL DLGFDATATH AELELGPGGA VPVAANPEPG       480
     PPQSALPRPS ARVLDASGRP LPPGTPVPRG RVVVEVELVG APAQHGLAGL AGFGLWLDGT       540
     RIASVPTAVG GPAVAGTYRV AVNTGALPGG PLSEGPHMVE ARLFGTSGST RPTSAFASFF       600
     AAR                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page