(data stored in ACNUC7421 zone)

EMBL: CP001630.PE163

CP001630.PE163       Location/Qualifiers
FT   CDS             complement(181830..182186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34137.1"
FT                   /translation="MTGGEVGAPVLDSWSPPLPATPPVRTRFARDGDRVRLVVSLLDPL
FT                   ARELLPLRELRVDLDGERLAVVPLGGSVGGVHEFEVSGVEPGGHRVRVEVEPEQLDLAT
FT                   TVRETEVTQSLPPR"
     MTGGEVGAPV LDSWSPPLPA TPPVRTRFAR DGDRVRLVVS LLDPLARELL PLRELRVDLD        60
     GERLAVVPLG GSVGGVHEFE VSGVEPGGHR VRVEVEPEQL DLATTVRETE VTQSLPPR         118
//

If you have problems or comments...

PBIL Back to PBIL home page