(data stored in ACNUC7421 zone)

EMBL: CP001630.PE165

CP001630.PE165       Location/Qualifiers
FT   CDS             complement(183317..184273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0168"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: gsu:GSU2607
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34139"
FT                   /db_xref="GOA:C6WDZ4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ4"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACU34139.1"
FT                   /translation="MRELCVVGLGLIGGSVLRAAVAAGWTAWGATASEEDAGTARADGF
FT                   DVVDLVEALARAQRSDALVVLAVPLPAVERVLRMLPAGVRLTDVVSVKGPVADLVGRCA
FT                   PSARYVGGHPMAGTSASGWAASDVALFRGAAWVVAAEDGCDLDVLGDVVRLALAVGAHV
FT                   VPTDADEHDVAVARVSHLPHVLAAVLASVGAEGGPLALALAAGSFGDATRVAGSDPDLV
FT                   RAMCEGNRNALLGAVDDALGRLGAARGSLASTGGLAKTIDAGHAARGRLDALRADEGAE
FT                   VTVDLAARDAREALRAVGARGGRVVALDGTTALARTF"
     MRELCVVGLG LIGGSVLRAA VAAGWTAWGA TASEEDAGTA RADGFDVVDL VEALARAQRS        60
     DALVVLAVPL PAVERVLRML PAGVRLTDVV SVKGPVADLV GRCAPSARYV GGHPMAGTSA       120
     SGWAASDVAL FRGAAWVVAA EDGCDLDVLG DVVRLALAVG AHVVPTDADE HDVAVARVSH       180
     LPHVLAAVLA SVGAEGGPLA LALAAGSFGD ATRVAGSDPD LVRAMCEGNR NALLGAVDDA       240
     LGRLGAARGS LASTGGLAKT IDAGHAARGR LDALRADEGA EVTVDLAARD AREALRAVGA       300
     RGGRVVALDG TTALARTF                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page