(data stored in ACNUC7421 zone)

EMBL: CP001630.PE166

CP001630.PE166       Location/Qualifiers
FT   CDS             complement(184371..185606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0169"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sal:Sala_2314 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerization domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34140"
FT                   /db_xref="GOA:C6WDZ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ5"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACU34140.1"
FT                   /translation="MSTPAPSPSEHTEDPRFTGLSEEARALQPRTVALRRQVHRHPEQG
FT                   LDLPRTQAAVLHALEGLPLEITTGTTSSSVVAVLRGERPGPTVLLRGDMDALPVQEETG
FT                   LDYASEVPGAMHACGHDAHVAMLASAARLLSGRRDALAGQVLFMFQPGEEGHHGARFML
FT                   EEGLLDAAGARPVKALALHVSATVASGVVLTRPGPMMASADTFRVLVRGRGGHGGMPHD
FT                   ALDPVPAAAAMVGALQTMVARRVSVHRPAVVTVGRIEAGTTNNVIPETALLEGTIRTLS
FT                   EETRTLVHRELVAVCEHVAAAHGCAAEVEVTPGYPVTVNDAEVAPRLLELASTVLGPRW
FT                   VAEAEDPLMGAEDFSYVLREVPGAMAFLGACPRGVDLARAEPNHSGRALFDEAALEHGV
FT                   VVYSAFALDALR"
     MSTPAPSPSE HTEDPRFTGL SEEARALQPR TVALRRQVHR HPEQGLDLPR TQAAVLHALE        60
     GLPLEITTGT TSSSVVAVLR GERPGPTVLL RGDMDALPVQ EETGLDYASE VPGAMHACGH       120
     DAHVAMLASA ARLLSGRRDA LAGQVLFMFQ PGEEGHHGAR FMLEEGLLDA AGARPVKALA       180
     LHVSATVASG VVLTRPGPMM ASADTFRVLV RGRGGHGGMP HDALDPVPAA AAMVGALQTM       240
     VARRVSVHRP AVVTVGRIEA GTTNNVIPET ALLEGTIRTL SEETRTLVHR ELVAVCEHVA       300
     AAHGCAAEVE VTPGYPVTVN DAEVAPRLLE LASTVLGPRW VAEAEDPLMG AEDFSYVLRE       360
     VPGAMAFLGA CPRGVDLARA EPNHSGRALF DEAALEHGVV VYSAFALDAL R                411
//

If you have problems or comments...

PBIL Back to PBIL home page