(data stored in ACNUC7421 zone)

EMBL: CP001630.PE168

CP001630.PE168       Location/Qualifiers
FT   CDS             186174..186656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0171"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gur:Gura_0055 CMP/dCMP deaminase, zinc- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34142"
FT                   /db_xref="GOA:C6WDZ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACU34142.1"
FT                   /translation="MITAPYDAMVGAALEAAAGAGEDIPIGAAVFGPDGAELARACNAR
FT                   ERLGDPTAHAEVLALRAAAAVFGDGWRLGGCTLAVTVEPCAMCAGALVLARVDRVVFGA
FT                   WEPKTGAAGSLWDVVRDRRLNHRAEVVGGVREAECAALMRDFFAGRDTSERWPESG"
     MITAPYDAMV GAALEAAAGA GEDIPIGAAV FGPDGAELAR ACNARERLGD PTAHAEVLAL        60
     RAAAAVFGDG WRLGGCTLAV TVEPCAMCAG ALVLARVDRV VFGAWEPKTG AAGSLWDVVR       120
     DRRLNHRAEV VGGVREAECA ALMRDFFAGR DTSERWPESG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page