(data stored in ACNUC7421 zone)

EMBL: CP001630.PE169

CP001630.PE169       Location/Qualifiers
FT   CDS             complement(186876..188189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0172"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sus:Acid_5994
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34143"
FT                   /db_xref="GOA:C6WDZ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACU34143.1"
FT                   /translation="MPREKKGRSANGRSSIYYSETDQSWHGWVTVGTKDNGQSDRRHVR
FT                   GKNQDEVSDKVSKLERMRDQGRVTKAGQNWTVETWLKHWLENIVAPPVVSENAYSAYEV
FT                   AVRVHLVPGIGAHRLVKLQPEHLEKLYRAIMRKSTKFGPTTSSSTAHQVHRTIRAALNV
FT                   AVRRKHLTENPALEARAPKLEETEVEPYSVDQVKALLVTALKRRNSARWAIALALGLRQ
FT                   GEALGLRWQDVDLEVGTLVVRRNRLRPKWRHGCTEPCGKKHGGYCPQRVALREETAGTK
FT                   SAAGKRGMGLPDELVRLLRVHRDVQARERERAAELWTDTGYVFTTPTGGPLNPRSDYDE
FT                   WKRLLDIAKVPDGRLHDARHTAATVLLLLGVPERTVMGIMGWSNTAMAARYQHVTAAIR
FT                   LDVAQRVGGLLWEPAEKPTEPRDEGEEGDATGALIPTA"
     MPREKKGRSA NGRSSIYYSE TDQSWHGWVT VGTKDNGQSD RRHVRGKNQD EVSDKVSKLE        60
     RMRDQGRVTK AGQNWTVETW LKHWLENIVA PPVVSENAYS AYEVAVRVHL VPGIGAHRLV       120
     KLQPEHLEKL YRAIMRKSTK FGPTTSSSTA HQVHRTIRAA LNVAVRRKHL TENPALEARA       180
     PKLEETEVEP YSVDQVKALL VTALKRRNSA RWAIALALGL RQGEALGLRW QDVDLEVGTL       240
     VVRRNRLRPK WRHGCTEPCG KKHGGYCPQR VALREETAGT KSAAGKRGMG LPDELVRLLR       300
     VHRDVQARER ERAAELWTDT GYVFTTPTGG PLNPRSDYDE WKRLLDIAKV PDGRLHDARH       360
     TAATVLLLLG VPERTVMGIM GWSNTAMAAR YQHVTAAIRL DVAQRVGGLL WEPAEKPTEP       420
     RDEGEEGDAT GALIPTA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page