(data stored in ACNUC7421 zone)

EMBL: CP001630.PE17

CP001630.PE17        Location/Qualifiers
FT   CDS             17775..18836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0017"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: sus:Acid_5377 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33991"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH0"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU33991.1"
FT                   /translation="MLRPVGDAPTQYAQPVGRSLPPPPGRPVAPPRHRAPRRPVEPPTE
FT                   VIPRFEDDRDDYEDPQDDLDRDDLDRDDLDRDERAGADRHEPEYPPEGPLRKVVRGTGE
FT                   ALITLGLVVLLFVVYEVYVTDLISAGKQDDVTSALDEEWKDSNTVAADPQREVKYDLLD
FT                   GKAFAKIYIPVFGADYKFSIVEGTTDKDLETGPGHYKGTALPGEKGNFAVAGHRVGKGS
FT                   PFNDLDLLSSCDAIVVETQASWFVYRMLPKNSEVAGWASRASDPRCKDVAPLSGPYSKT
FT                   QGQEIVLPSAGEVINEVPYNEAQVPEDQLKSLMTLTTCHPRFSDKQRLIVHATLAQHYP
FT                   KSDGFLPPELKEQ"
     MLRPVGDAPT QYAQPVGRSL PPPPGRPVAP PRHRAPRRPV EPPTEVIPRF EDDRDDYEDP        60
     QDDLDRDDLD RDDLDRDERA GADRHEPEYP PEGPLRKVVR GTGEALITLG LVVLLFVVYE       120
     VYVTDLISAG KQDDVTSALD EEWKDSNTVA ADPQREVKYD LLDGKAFAKI YIPVFGADYK       180
     FSIVEGTTDK DLETGPGHYK GTALPGEKGN FAVAGHRVGK GSPFNDLDLL SSCDAIVVET       240
     QASWFVYRML PKNSEVAGWA SRASDPRCKD VAPLSGPYSK TQGQEIVLPS AGEVINEVPY       300
     NEAQVPEDQL KSLMTLTTCH PRFSDKQRLI VHATLAQHYP KSDGFLPPEL KEQ              353
//

If you have problems or comments...

PBIL Back to PBIL home page