(data stored in ACNUC7421 zone)

EMBL: CP001630.PE170

CP001630.PE170       Location/Qualifiers
FT   CDS             complement(188197..188499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0173"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34144"
FT                   /db_xref="GOA:C6WDZ9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34144.1"
FT                   /translation="MSTNGRNAEIAELIARLTVLMTASPERQVPAQRPAPVRVLLTVEE
FT                   AAERLGIGKTKAYALVKAGSLESVLIGRLRRVHVDAIDHYTARLVAEQSSARPAA"
     MSTNGRNAEI AELIARLTVL MTASPERQVP AQRPAPVRVL LTVEEAAERL GIGKTKAYAL        60
     VKAGSLESVL IGRLRRVHVD AIDHYTARLV AEQSSARPAA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page