(data stored in ACNUC7421 zone)

EMBL: CP001630.PE171

CP001630.PE171       Location/Qualifiers
FT   CDS             complement(188496..189647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34145"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:C6WE00"
FT                   /inference="similar to AA sequence:KEGG:RSc2483"
FT                   /protein_id="ACU34145.1"
FT                   /translation="MSAALRAVPTAQPAPGHVVLDQVRDFVKRFSVFPDEHCAPTLALW
FT                   YAHTWVADAFYTTPRLVLSSPEAGSGKTRVLEIAQHLTREPEMTAGGSAAALVRMVAAG
FT                   PISILMDEVDTVFGTGGAGNEEVRQMLNLGYKRTATIPKTKGDPASGFTVERLPIFAPA
FT                   ALAGLAGRMPDTITTRAITIHLRRRRHDEPVEPYRESKVVRQATPIREALGDWTASIGE
FT                   NLIEAEPDMPPGVEDRPAEIWEPLLAIADVAGGHWPETARAACSHFVLNQKSTQTLGVR
FT                   LLDDLRALFTAEGTERMHTAEIVTRLRGLEDAPWADLNGKPLDSRQLARQLSLYQVAPL
FT                   TFKHKNTNAKGYVTYPTNTQVTQVGLADAWARYLAPEHNGGAV"
     MSAALRAVPT AQPAPGHVVL DQVRDFVKRF SVFPDEHCAP TLALWYAHTW VADAFYTTPR        60
     LVLSSPEAGS GKTRVLEIAQ HLTREPEMTA GGSAAALVRM VAAGPISILM DEVDTVFGTG       120
     GAGNEEVRQM LNLGYKRTAT IPKTKGDPAS GFTVERLPIF APAALAGLAG RMPDTITTRA       180
     ITIHLRRRRH DEPVEPYRES KVVRQATPIR EALGDWTASI GENLIEAEPD MPPGVEDRPA       240
     EIWEPLLAIA DVAGGHWPET ARAACSHFVL NQKSTQTLGV RLLDDLRALF TAEGTERMHT       300
     AEIVTRLRGL EDAPWADLNG KPLDSRQLAR QLSLYQVAPL TFKHKNTNAK GYVTYPTNTQ       360
     VTQVGLADAW ARYLAPEHNG GAV                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page