(data stored in ACNUC7421 zone)

EMBL: CP001630.PE174

CP001630.PE174       Location/Qualifiers
FT   CDS             complement(190727..192922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0177"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG:
FT                   bac:BamMC406_0006 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34148"
FT                   /db_xref="GOA:C6WF16"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF16"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34148.1"
FT                   /translation="MSLPTARSTPDPDENNVVHLADARARAAATEPTAVVERAPEVLDA
FT                   EVVEDDAPTELVQVDQPDSSDDSTWVSRLRETERLPIIPGYLRTLSEVRQTAAWVGRHY
FT                   AHATGYHAARTPLYLLKLAARSPQGALLLMAATGRWVADAEGRPLRREMAVRGEAEKYL
FT                   RLVQERNARVRFRTVLLAAGSALGVVLLVLLPGVAPEWVWWVCVTAALAVLGKLGTPQD
FT                   RPVAGRAVVGPQAQKLTSDVVVRALSSLGIGGINQAVGKNAHAIGFTAPITRDGPGWRA
FT                   DVELPPGVTATEVVEKRDKLASGLGRPLGCVWPENNASGHPGQLVLWVGDRDMSKAKQP
FT                   AWSLRRGGAVDLFKPQPFGTDVRGRWVEVTLMFVAGIIGAIPRMGKTFTLRELLLIAAL
FT                   DPRSELHSYDLKGTGDLSPLAPVCHRYRAGDDPEDLEYAVADLRALRQELRRRTKVIRE
FT                   LPKDLCPENKVTTELASKRSLRLHPIVIGVDECQVWFEHPEFGAEVEEICTDLVKRGPA
FT                   TGIVLLLATQRPDSKSIPTQISDNAVLRFCLKVTGQMANDMVLGTSSYRNGERATQFSF
FT                   SDKGIGLLKGVTDETKTVKGVYVDGPGAETIAGRARALRTAAGLLTGYAAGLDAEVVDG
FT                   DVTSTLLPDVLAAMGSADKMWSESIVERLAELRPGAYGQWADQDGKGRAVQLAAALKPH
FT                   GVSTGQVWGTDADGKGANRRGLTRADVAAAVTDSASK"
     MSLPTARSTP DPDENNVVHL ADARARAAAT EPTAVVERAP EVLDAEVVED DAPTELVQVD        60
     QPDSSDDSTW VSRLRETERL PIIPGYLRTL SEVRQTAAWV GRHYAHATGY HAARTPLYLL       120
     KLAARSPQGA LLLMAATGRW VADAEGRPLR REMAVRGEAE KYLRLVQERN ARVRFRTVLL       180
     AAGSALGVVL LVLLPGVAPE WVWWVCVTAA LAVLGKLGTP QDRPVAGRAV VGPQAQKLTS       240
     DVVVRALSSL GIGGINQAVG KNAHAIGFTA PITRDGPGWR ADVELPPGVT ATEVVEKRDK       300
     LASGLGRPLG CVWPENNASG HPGQLVLWVG DRDMSKAKQP AWSLRRGGAV DLFKPQPFGT       360
     DVRGRWVEVT LMFVAGIIGA IPRMGKTFTL RELLLIAALD PRSELHSYDL KGTGDLSPLA       420
     PVCHRYRAGD DPEDLEYAVA DLRALRQELR RRTKVIRELP KDLCPENKVT TELASKRSLR       480
     LHPIVIGVDE CQVWFEHPEF GAEVEEICTD LVKRGPATGI VLLLATQRPD SKSIPTQISD       540
     NAVLRFCLKV TGQMANDMVL GTSSYRNGER ATQFSFSDKG IGLLKGVTDE TKTVKGVYVD       600
     GPGAETIAGR ARALRTAAGL LTGYAAGLDA EVVDGDVTST LLPDVLAAMG SADKMWSESI       660
     VERLAELRPG AYGQWADQDG KGRAVQLAAA LKPHGVSTGQ VWGTDADGKG ANRRGLTRAD       720
     VAAAVTDSAS K                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page