(data stored in ACNUC7421 zone)

EMBL: CP001630.PE175

CP001630.PE175       Location/Qualifiers
FT   CDS             complement(192919..193884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmv:BMASAVP1_A1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34149"
FT                   /db_xref="GOA:C6WF17"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34149.1"
FT                   /translation="MTSAYPPQLDRLAMKVDKLADDHGRLPSRNEVMRTFKVGGPKAKA
FT                   ALDAVKAMRSAGFVAGTSLVTSPTRRLHSVPTPDEGTAEDTTEFGTEHDAAPAAEHAEP
FT                   ASAPADITTSTTVDAVVPTPATRAEPAPSTQVSTLADLGTPHVPTGGAVEQGRVRGAWA
FT                   VLTNRTAEPRQARQVRPWPVLVIALGAFVAIWGGWVELGKLTGFGEITPLPGIADGWTI
FT                   DSAITLPLGVEAYAAFALRVWLSDTTRSGRARRFAKWSALGALVLGAAGQVAYHLMSAA
FT                   GLTSAPWQITTAVSCLPVIVLGLGAALAHLMHNGDQEVTR"
     MTSAYPPQLD RLAMKVDKLA DDHGRLPSRN EVMRTFKVGG PKAKAALDAV KAMRSAGFVA        60
     GTSLVTSPTR RLHSVPTPDE GTAEDTTEFG TEHDAAPAAE HAEPASAPAD ITTSTTVDAV       120
     VPTPATRAEP APSTQVSTLA DLGTPHVPTG GAVEQGRVRG AWAVLTNRTA EPRQARQVRP       180
     WPVLVIALGA FVAIWGGWVE LGKLTGFGEI TPLPGIADGW TIDSAITLPL GVEAYAAFAL       240
     RVWLSDTTRS GRARRFAKWS ALGALVLGAA GQVAYHLMSA AGLTSAPWQI TTAVSCLPVI       300
     VLGLGAALAH LMHNGDQEVT R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page