(data stored in ACNUC7421 zone)

EMBL: CP001630.PE179

CP001630.PE179       Location/Qualifiers
FT   CDS             194728..195081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0182"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34153"
FT                   /db_xref="GOA:C6WF21"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF21"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34153.1"
FT                   /translation="MIPDWEGVATAINARLSDRGMKQQELAERSGVSVAALRLLQKAKA
FT                   TNARPRTLAAVSEALGWPREHLAAVRDGRTPSDGAARPEPTVAELAAAMEDLRERVAEL
FT                   ERVVGEGSSERRA"
     MIPDWEGVAT AINARLSDRG MKQQELAERS GVSVAALRLL QKAKATNARP RTLAAVSEAL        60
     GWPREHLAAV RDGRTPSDGA ARPEPTVAEL AAAMEDLRER VAELERVVGE GSSERRA          117
//

If you have problems or comments...

PBIL Back to PBIL home page