(data stored in ACNUC7421 zone)

EMBL: CP001630.PE18

CP001630.PE18        Location/Qualifiers
FT   CDS             18838..18996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33992"
FT                   /db_xref="GOA:C6WCH1"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33992.1"
FT                   /translation="MYSWIWRHLPGPLPVRVLEAVVLVAGVVALLMFVVFPWAEPMLPF
FT                   NQVTTEQ"
     MYSWIWRHLP GPLPVRVLEA VVLVAGVVAL LMFVVFPWAE PMLPFNQVTT EQ                52
//

If you have problems or comments...

PBIL Back to PBIL home page