(data stored in ACNUC7421 zone)

EMBL: CP001630.PE181

CP001630.PE181       Location/Qualifiers
FT   CDS             196208..196987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0184"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: smt:Smal_1152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34155"
FT                   /db_xref="GOA:C6WF23"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF23"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACU34155.1"
FT                   /translation="MELNGAPVTLEEVKALALTNYGHFTSMLAEDGKVRGLSLHLQRLA
FT                   RDCRLLFDVELDTDMVRHCVRSALPDSGDRTVVRVTSYDPGIDLGTIGSDATPHILVTK
FT                   RSASDKVPSPMRLQAASYQRELPTVKHIGLFGALQRRRTAQREGFDDVLFLNPDGYISE
FT                   VATSNIGFVRDGQIVWPRAAYLAGITMTLLHQELDEPVSTEPLSLADLGQMEAAFATNA
FT                   STGVREILSVDDVAWESGHPMLGELRKMYEDIPAETV"
     MELNGAPVTL EEVKALALTN YGHFTSMLAE DGKVRGLSLH LQRLARDCRL LFDVELDTDM        60
     VRHCVRSALP DSGDRTVVRV TSYDPGIDLG TIGSDATPHI LVTKRSASDK VPSPMRLQAA       120
     SYQRELPTVK HIGLFGALQR RRTAQREGFD DVLFLNPDGY ISEVATSNIG FVRDGQIVWP       180
     RAAYLAGITM TLLHQELDEP VSTEPLSLAD LGQMEAAFAT NASTGVREIL SVDDVAWESG       240
     HPMLGELRKM YEDIPAETV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page