(data stored in ACNUC7421 zone)

EMBL: CP001630.PE182

CP001630.PE182       Location/Qualifiers
FT   CDS             197023..197958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0185"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF323; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce5487 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34156"
FT                   /db_xref="GOA:C6WF24"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF24"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACU34156.1"
FT                   /translation="MATVQSWSGVEVRALREAKRMSIREFAAHLGVSERMISKWEAGRE
FT                   SIRPRPVNQAALDTCLTRSDPDTKARFSLLTGDSLVPGSGENVQVEPIGSSQVHHPADG
FT                   SLMVKVDGSVFLSGPSNTPVWIPDFYIDVYPVSNADYARFIVATGHAPPHHWPDGRHPA
FT                   ELVDHPVVFVTWEDAAAYAAWAGKALPTSQQWEKAARGTRGTVYPWGDQPTPAKCNVRE
FT                   NGVGQTTRRDCYQSGASPYGVYDLCGNVWEWCATESKPGRRELRGGAWTSPFNRATPSS
FT                   FNDAAVSMCDDDTGFRCVAPVEAFGGREAK"
     MATVQSWSGV EVRALREAKR MSIREFAAHL GVSERMISKW EAGRESIRPR PVNQAALDTC        60
     LTRSDPDTKA RFSLLTGDSL VPGSGENVQV EPIGSSQVHH PADGSLMVKV DGSVFLSGPS       120
     NTPVWIPDFY IDVYPVSNAD YARFIVATGH APPHHWPDGR HPAELVDHPV VFVTWEDAAA       180
     YAAWAGKALP TSQQWEKAAR GTRGTVYPWG DQPTPAKCNV RENGVGQTTR RDCYQSGASP       240
     YGVYDLCGNV WEWCATESKP GRRELRGGAW TSPFNRATPS SFNDAAVSMC DDDTGFRCVA       300
     PVEAFGGREA K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page