(data stored in ACNUC7421 zone)

EMBL: CP001630.PE183

CP001630.PE183       Location/Qualifiers
FT   CDS             complement(198068..198250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34157"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34157.1"
FT                   /translation="MDDRRRTNENTAKPDPNRTDESQKRGGYLAPAIPFELPKAPPGPG
FT                   QGGAPTTDKGGQTDK"
     MDDRRRTNEN TAKPDPNRTD ESQKRGGYLA PAIPFELPKA PPGPGQGGAP TTDKGGQTDK        60
//

If you have problems or comments...

PBIL Back to PBIL home page