(data stored in ACNUC7421 zone)

EMBL: CP001630.PE184

CP001630.PE184       Location/Qualifiers
FT   CDS             complement(198251..198898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34158"
FT                   /db_xref="GOA:C6WF26"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34158.1"
FT                   /translation="MIATFQGLLVALLALLPGASYTFAYERVAGGYGISFADRLVRFLA
FT                   SSALFHALFSGPEYLLYRDLFKNNRLQGGGVDWWLVEAVALAYVLVPVAVGALLGWGHK
FT                   HHKKWAVLLVGNAPEPRAWDYFWRHTDRAVVRLKLKSGMWLAGLYGMAGNGRRSYASGH
FT                   PEEGDLYLAVALEINNQSGELTLTDEQVTPLPGARGLLVRWPEIEYIDIQEY"
     MIATFQGLLV ALLALLPGAS YTFAYERVAG GYGISFADRL VRFLASSALF HALFSGPEYL        60
     LYRDLFKNNR LQGGGVDWWL VEAVALAYVL VPVAVGALLG WGHKHHKKWA VLLVGNAPEP       120
     RAWDYFWRHT DRAVVRLKLK SGMWLAGLYG MAGNGRRSYA SGHPEEGDLY LAVALEINNQ       180
     SGELTLTDEQ VTPLPGARGL LVRWPEIEYI DIQEY                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page