(data stored in ACNUC7421 zone)

EMBL: CP001630.PE185

CP001630.PE185       Location/Qualifiers
FT   CDS             complement(198895..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C1257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF27"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C1257"
FT                   /protein_id="ACU34159.1"
FT                   /translation="MIIGVSGHQDLPASAQAHAEKRIRALLAEQAAPVTGVGSLAEGAD
FT                   QLFAQLVLAAGGSLHVVIPSRGYETTFAVEARCLYRELLARADTVTELDFPEPGEQAYY
FT                   AAGHHVAECCDLLVAVWDGQPARGLGGTADAVAHARELGRDVMIVWPEGVRRT"
     MIIGVSGHQD LPASAQAHAE KRIRALLAEQ AAPVTGVGSL AEGADQLFAQ LVLAAGGSLH        60
     VVIPSRGYET TFAVEARCLY RELLARADTV TELDFPEPGE QAYYAAGHHV AECCDLLVAV       120
     WDGQPARGLG GTADAVAHAR ELGRDVMIVW PEGVRRT                                157
//

If you have problems or comments...

PBIL Back to PBIL home page