(data stored in ACNUC7421 zone)

EMBL: CP001630.PE186

CP001630.PE186       Location/Qualifiers
FT   CDS             complement(199368..200309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0189"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: bcr:BCAH187_E0055 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34160"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF28"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACU34160.1"
FT                   /translation="MKRALLVGIDRYKNFQPLAGCVNDANAVKPLLARNEDNSLNFHCK
FT                   LLLDAVERDQLLEEVDALLGGGADFALLYFAGHGAGVGDDLTLVTTNGTPQSPGVRFAD
FT                   VLERIGRSPVREVVVILDCCFSGNAGNVPVLGAGSAYLREGLSILTASRGDQTSAEARG
FT                   RGVFSTYLEGALDGGASDVMGHVTVAGLYAYLSELFGAWDQRPTFKANVDRLQDLRACK
FT                   SAVPLDTLRSLADWFPTAEAEFPLDPSYEPDAEPENLEHEDVFKQLQVCRANKLVEPID
FT                   TDHMYYAAMNSTGCRLTPLGKRYWQLAERENI"
     MKRALLVGID RYKNFQPLAG CVNDANAVKP LLARNEDNSL NFHCKLLLDA VERDQLLEEV        60
     DALLGGGADF ALLYFAGHGA GVGDDLTLVT TNGTPQSPGV RFADVLERIG RSPVREVVVI       120
     LDCCFSGNAG NVPVLGAGSA YLREGLSILT ASRGDQTSAE ARGRGVFSTY LEGALDGGAS       180
     DVMGHVTVAG LYAYLSELFG AWDQRPTFKA NVDRLQDLRA CKSAVPLDTL RSLADWFPTA       240
     EAEFPLDPSY EPDAEPENLE HEDVFKQLQV CRANKLVEPI DTDHMYYAAM NSTGCRLTPL       300
     GKRYWQLAER ENI                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page