(data stored in ACNUC7421 zone)

EMBL: CP001630.PE187

CP001630.PE187       Location/Qualifiers
FT   CDS             complement(200314..200691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0190"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   sbm:Shew185_4383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34161"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR036490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF29"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACU34161.1"
FT                   /translation="MADKKTVFIAFAMEDERDRDLFVGQRLNSRTPYEYTDMSVKEPYE
FT                   TQWKERVLARVRRSHGVIALISPSTVQAEGQLWEIECAVEEGKPLLGIFIKEQRIKPAV
FT                   MGSAPCVAWTWKAVEDFIDGL"
     MADKKTVFIA FAMEDERDRD LFVGQRLNSR TPYEYTDMSV KEPYETQWKE RVLARVRRSH        60
     GVIALISPST VQAEGQLWEI ECAVEEGKPL LGIFIKEQRI KPAVMGSAPC VAWTWKAVED       120
     FIDGL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page