(data stored in ACNUC7421 zone)

EMBL: CP001630.PE188

CP001630.PE188       Location/Qualifiers
FT   CDS             complement(201557..202771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0191"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   bmj:BMULJ_02352 protein-L-isoaspartate (D- aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34162"
FT                   /db_xref="GOA:C6WF30"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR026448"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF30"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACU34162.1"
FT                   /translation="MTTVPEDEWRERAAALADMLGELGKLTDPAWREAVRAVPRHVLVP
FT                   RFHTQDTNGTWVESSTSTKEGRAAWLDAVYSNKPLVTALRQDAEVGRVVSSSSQPGLMT
FT                   RMLEALDIRDGHRVLEIGTGTGYNAALLSHRLGGENVFSVDVEPDLVDLARSRLAELGH
FT                   APTLVAANGALGLAEHAPFDRIIATCAVPAIPWAWIEQLRVGGTVLTDLKITQNAGNLV
FT                   KVTRTSEHRAEGRFDPTYAAFMGLRHQPGGPAQPVTRAARDSADVHESTSPVDPQTPWK
FT                   NMVVWFLAALDLHADVTIGYTGPSTTSPPTAVTLSTSDGSWAQIALAGAHGLHEVTQGG
FT                   PQRLWQAVENAHDLWNHLSRPDWGQFGLTITPNSHTLWHDRPDSEQHWTHLTEMIHGKR
FT                   WAKQL"
     MTTVPEDEWR ERAAALADML GELGKLTDPA WREAVRAVPR HVLVPRFHTQ DTNGTWVESS        60
     TSTKEGRAAW LDAVYSNKPL VTALRQDAEV GRVVSSSSQP GLMTRMLEAL DIRDGHRVLE       120
     IGTGTGYNAA LLSHRLGGEN VFSVDVEPDL VDLARSRLAE LGHAPTLVAA NGALGLAEHA       180
     PFDRIIATCA VPAIPWAWIE QLRVGGTVLT DLKITQNAGN LVKVTRTSEH RAEGRFDPTY       240
     AAFMGLRHQP GGPAQPVTRA ARDSADVHES TSPVDPQTPW KNMVVWFLAA LDLHADVTIG       300
     YTGPSTTSPP TAVTLSTSDG SWAQIALAGA HGLHEVTQGG PQRLWQAVEN AHDLWNHLSR       360
     PDWGQFGLTI TPNSHTLWHD RPDSEQHWTH LTEMIHGKRW AKQL                        404
//

If you have problems or comments...

PBIL Back to PBIL home page