(data stored in ACNUC7421 zone)

EMBL: CP001630.PE189

CP001630.PE189       Location/Qualifiers
FT   CDS             complement(202768..203733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34163"
FT                   /db_xref="InterPro:IPR026449"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF31"
FT                   /inference="similar to AA sequence:KEGG:sce7176"
FT                   /protein_id="ACU34163.1"
FT                   /translation="MTVLILAQEADAPTDAVVAELTRRGVEVFRADTSWFPRQLVLDAE
FT                   LVDGRWTGTLSTDHRTVDLHDIRSVWYRDPSAFVFPPDLTEVERAYAHREARLGFGGVL
FT                   AALPDVLWVNHPNRAADAMYKPLQLTTAAACGLYVVPTLVTNSPTAVRRFAAALPGGVV
FT                   HKSFGPNTVTEGGAVKVAYTRRFQPADLVDLRGVRSTALQAQAWVDKAVEARVVVLGER
FT                   MFTIVITANSTAAHEDWRADFDALTYELVDTPPEVEAGVRAYMRTLGLAYAALDFGIER
FT                   DTGRFVFYESNSAGQYGWLESQTGAPITAALADLLTGVPS"
     MTVLILAQEA DAPTDAVVAE LTRRGVEVFR ADTSWFPRQL VLDAELVDGR WTGTLSTDHR        60
     TVDLHDIRSV WYRDPSAFVF PPDLTEVERA YAHREARLGF GGVLAALPDV LWVNHPNRAA       120
     DAMYKPLQLT TAAACGLYVV PTLVTNSPTA VRRFAAALPG GVVHKSFGPN TVTEGGAVKV       180
     AYTRRFQPAD LVDLRGVRST ALQAQAWVDK AVEARVVVLG ERMFTIVITA NSTAAHEDWR       240
     ADFDALTYEL VDTPPEVEAG VRAYMRTLGL AYAALDFGIE RDTGRFVFYE SNSAGQYGWL       300
     ESQTGAPITA ALADLLTGVP S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page