(data stored in ACNUC7421 zone)

EMBL: CP001630.PE19

CP001630.PE19        Location/Qualifiers
FT   CDS             complement(19042..20388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0019"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ade:Adeh_3296 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33993"
FT                   /db_xref="GOA:C6WCH2"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH2"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ACU33993.1"
FT                   /translation="MSRSLRVAVVGAGPAGIYAADILTKSDAEVSIDLFERMPAPYGLI
FT                   RYGVAPDHPRIKGIVNALQKVLDRPEIRFFGNVEYGVDVKLEDLRQHYDAVIFSTGAEK
FT                   DRAMDVPGIELDGSYGAADFVSWYDGHPDVPRTWPLTASQVAVLGVGNVALDVARVLAK
FT                   TADELLTTEIPDNVYEGLKSSPVTDVHVFGRRGPAQAKFTPLELRELDHSPNVEVIVHP
FT                   EGIDFDEGSMASIRSSKQVEMVVKTLQEWALRDVGDRPRRLHLHFLEAPVEVTGEDGKV
FT                   VGLRTERMELAGDGNVKGTGEFTDWPVQAVYRAVGYLSTSLVDLPFDTASGTVPHAGGR
FT                   VVDLDEQPLPGVYVTGWIKRGPVGLIGHTKGDALETVTNLLADADALPACQFPEPDAIV
FT                   RFLEQRAVPFTTVEGWLKLDAHEKALGAERGRERVKVVDRETMTSVSRS"
     MSRSLRVAVV GAGPAGIYAA DILTKSDAEV SIDLFERMPA PYGLIRYGVA PDHPRIKGIV        60
     NALQKVLDRP EIRFFGNVEY GVDVKLEDLR QHYDAVIFST GAEKDRAMDV PGIELDGSYG       120
     AADFVSWYDG HPDVPRTWPL TASQVAVLGV GNVALDVARV LAKTADELLT TEIPDNVYEG       180
     LKSSPVTDVH VFGRRGPAQA KFTPLELREL DHSPNVEVIV HPEGIDFDEG SMASIRSSKQ       240
     VEMVVKTLQE WALRDVGDRP RRLHLHFLEA PVEVTGEDGK VVGLRTERME LAGDGNVKGT       300
     GEFTDWPVQA VYRAVGYLST SLVDLPFDTA SGTVPHAGGR VVDLDEQPLP GVYVTGWIKR       360
     GPVGLIGHTK GDALETVTNL LADADALPAC QFPEPDAIVR FLEQRAVPFT TVEGWLKLDA       420
     HEKALGAERG RERVKVVDRE TMTSVSRS                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page