(data stored in ACNUC7421 zone)

EMBL: CP001630.PE190

CP001630.PE190       Location/Qualifiers
FT   CDS             complement(203733..204038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34164"
FT                   /db_xref="InterPro:IPR025843"
FT                   /db_xref="InterPro:IPR026496"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34164.1"
FT                   /translation="MADLPGTLVDTNPLSSSQLRNTIRAHAVSTAPGPDETRPFGLRFA
FT                   VTVPTPVRRTVSYCPTRQLAVDNERRPLIETMGKEWATKGSTDGDEGPEENWGWEE"
     MADLPGTLVD TNPLSSSQLR NTIRAHAVST APGPDETRPF GLRFAVTVPT PVRRTVSYCP        60
     TRQLAVDNER RPLIETMGKE WATKGSTDGD EGPEENWGWE E                           101
//

If you have problems or comments...

PBIL Back to PBIL home page