(data stored in ACNUC7421 zone)

EMBL: CP001630.PE191

CP001630.PE191       Location/Qualifiers
FT   CDS             204230..205435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0194"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein;
FT                   Tetratricopeptide TPR_4; SMART: helix-turn-helix domain
FT                   protein; KEGG: eca:ECA3401 putative phage regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34165"
FT                   /db_xref="GOA:C6WF33"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF33"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34165.1"
FT                   /translation="MAASPPATGENITVLRKAAGLTQRQLATRANISLSLLSKVEVGDR
FT                   AASNALVAAVARALAVPIERVHGQPYQAEHRESGVDNAIDRLRAALRGYDLAPDESVPL
FT                   RPVERLRADVEGVSRRRRSGRYSRLAFTLPALLEELTLARHSVTGAREQEEVFELLVMA
FT                   FYAAHGLAYRLGYADLAESIEHKLGWAADRTSDPLAVGLAQWTRVNAFQAAGDYGRGLQ
FT                   LLDNARHQLDEHVDLTGSAAVTVYGSLHLRASTLASRAGDADTARAHLGAAAELGVRVR
FT                   RDRVHYQLTFGPTNTAIHDVAASVELGDPERAVRIGADFKRGSGLPATRIGHLHIDLAR
FT                   AHLMLGDRPGTLRALEQARRAAPEQTRFHPMVRETTRVLVSLHRRSNPDLSKFATWIGL
FT                   AD"
     MAASPPATGE NITVLRKAAG LTQRQLATRA NISLSLLSKV EVGDRAASNA LVAAVARALA        60
     VPIERVHGQP YQAEHRESGV DNAIDRLRAA LRGYDLAPDE SVPLRPVERL RADVEGVSRR       120
     RRSGRYSRLA FTLPALLEEL TLARHSVTGA REQEEVFELL VMAFYAAHGL AYRLGYADLA       180
     ESIEHKLGWA ADRTSDPLAV GLAQWTRVNA FQAAGDYGRG LQLLDNARHQ LDEHVDLTGS       240
     AAVTVYGSLH LRASTLASRA GDADTARAHL GAAAELGVRV RRDRVHYQLT FGPTNTAIHD       300
     VAASVELGDP ERAVRIGADF KRGSGLPATR IGHLHIDLAR AHLMLGDRPG TLRALEQARR       360
     AAPEQTRFHP MVRETTRVLV SLHRRSNPDL SKFATWIGLA D                           401
//

If you have problems or comments...

PBIL Back to PBIL home page