(data stored in ACNUC7421 zone)

EMBL: CP001630.PE192

CP001630.PE192       Location/Qualifiers
FT   CDS             206393..208858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0195"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   scl:sce0688 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34166"
FT                   /db_xref="GOA:C6WF34"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF34"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34166.1"
FT                   /translation="MRTTPLRAGLAAAAATVVSIASATPVTAAPSQDALIAEVYGGGGN
FT                   SGAVLTQDFVELANRASAPVAVDGWSVQYLPASASAASQWQVTPLTGSIAPNARYLVAQ
FT                   AKGAGGTTALPTPDATGATAMAAGAGTVALVSGTQPLTCKTAADCAAAPGVKDLVGYGT
FT                   TAVVREGGPTATLTSTTSAARPQLVDSDDNAADFTAGAPTPVNSKGEGVGQNPDPDPDP
FT                   DPDPQPGDKRIRDIQGATRISPLLGQKVTGVPGLVTATRATGDRGYWIQDAQPDGDPRT
FT                   SEGVFVYTGDAAPTVQPGDSVLVGGTIAEYRPGGVEAGNSNQTLTEITAPTTSVLSSGN
FT                   PLPAPERLAPPAGYLPTASGGSIEQLPLEPDKYALDYFESREGMLVEVVDARVTGPTNN
FT                   FGETWITTRPQDNPTARGGTVYLGYDQPNPGRLKAKAGSATPPVSDVGDVWSGSTVGNL
FT                   EYTNFGGYTLATKSVGAHAPGGTKPEVSDATGRHELSVATYNVENLAATNDQAKFDRLA
FT                   AAVVANLRSPDVVVLEEIQDDNGTANDGTVTASATYQRFTDAIVAKGGPRYQWRQIDPV
FT                   NNADGGAPGGNIRVGFLFNPGRVSFVDRAGGDATTPVSVVKSRGRAALSVSPGRIEPAN
FT                   EAWDASRKPLVGEFSFLGRTVFVLANHFNSKGGDQAMHGRYQEPVRSSEEQRLKQATLL
FT                   KGFVDEVKSVDRGANVVLAGDLNDYQFSPVVAKLTEGGQVVDLMSTLPANERYSYVYEG
FT                   NSQTLDHILLSSNVKRYRYDVVRINAEFADQASDHDPQVVKIRPSTGNQLLDHLVFGLE
FT                   DLADLFHRP"
     MRTTPLRAGL AAAAATVVSI ASATPVTAAP SQDALIAEVY GGGGNSGAVL TQDFVELANR        60
     ASAPVAVDGW SVQYLPASAS AASQWQVTPL TGSIAPNARY LVAQAKGAGG TTALPTPDAT       120
     GATAMAAGAG TVALVSGTQP LTCKTAADCA AAPGVKDLVG YGTTAVVREG GPTATLTSTT       180
     SAARPQLVDS DDNAADFTAG APTPVNSKGE GVGQNPDPDP DPDPDPQPGD KRIRDIQGAT       240
     RISPLLGQKV TGVPGLVTAT RATGDRGYWI QDAQPDGDPR TSEGVFVYTG DAAPTVQPGD       300
     SVLVGGTIAE YRPGGVEAGN SNQTLTEITA PTTSVLSSGN PLPAPERLAP PAGYLPTASG       360
     GSIEQLPLEP DKYALDYFES REGMLVEVVD ARVTGPTNNF GETWITTRPQ DNPTARGGTV       420
     YLGYDQPNPG RLKAKAGSAT PPVSDVGDVW SGSTVGNLEY TNFGGYTLAT KSVGAHAPGG       480
     TKPEVSDATG RHELSVATYN VENLAATNDQ AKFDRLAAAV VANLRSPDVV VLEEIQDDNG       540
     TANDGTVTAS ATYQRFTDAI VAKGGPRYQW RQIDPVNNAD GGAPGGNIRV GFLFNPGRVS       600
     FVDRAGGDAT TPVSVVKSRG RAALSVSPGR IEPANEAWDA SRKPLVGEFS FLGRTVFVLA       660
     NHFNSKGGDQ AMHGRYQEPV RSSEEQRLKQ ATLLKGFVDE VKSVDRGANV VLAGDLNDYQ       720
     FSPVVAKLTE GGQVVDLMST LPANERYSYV YEGNSQTLDH ILLSSNVKRY RYDVVRINAE       780
     FADQASDHDP QVVKIRPSTG NQLLDHLVFG LEDLADLFHR P                           821
//

If you have problems or comments...

PBIL Back to PBIL home page