(data stored in ACNUC7421 zone)

EMBL: CP001630.PE193

CP001630.PE193       Location/Qualifiers
FT   CDS             complement(208921..209328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0196"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: scl:sce5646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34167"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF35"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34167.1"
FT                   /translation="MAITLVNPDGLPQVEVYRQVAIGAGAKLVFVAGQVARDGDGNRIG
FT                   EGDLAAQAEQAYLNVGTALAAAGATLGDLAKLTIYVVDWRLDLMPVLMEGVNRAFARLG
FT                   GSSLAPVTLIGVAALAEPDLLIEIEATAVVE"
     MAITLVNPDG LPQVEVYRQV AIGAGAKLVF VAGQVARDGD GNRIGEGDLA AQAEQAYLNV        60
     GTALAAAGAT LGDLAKLTIY VVDWRLDLMP VLMEGVNRAF ARLGGSSLAP VTLIGVAALA       120
     EPDLLIEIEA TAVVE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page