(data stored in ACNUC7421 zone)

EMBL: CP001630.PE195

CP001630.PE195       Location/Qualifiers
FT   CDS             complement(210404..212551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0198"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: pca:Pcar_1336 putative methyl-accepting
FT                   chemotaxis protein (MCP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34169"
FT                   /db_xref="GOA:C6WF37"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF37"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34169.1"
FT                   /translation="MKRTRVTPLNLGLGHRLLALSIGTVIATAGVLVVVGAWQSDKFST
FT                   AAAGNVAELIQTDTDHVTSGVSTLTRTAGEAIQESVNSSMNVANAELAQRGGLRLDDSS
FT                   TTSWKAVNQLTQEATDVTLPRAEVSGAWLGQNRDQSTPTPLVDDIRSMVSATVTVFQKM
FT                   DDKGDLLRVATNVPNKAGERAIGTYIPATAQDGTPNAVAKAINSGTSYRGVAKVVDTWY
FT                   IAAYDPIKNANGDVIGALYVGIPQDKAIAQLSQAISDTTVGANGRVTVYSTAAADKGRI
FT                   IASTGGKDVGTTNADAADANGVKYVDEIVSKATSLGEGQVFNAVYQLPGLDGEPAAASP
FT                   TNVVYYGPYQWAIAVSSYGPDSAGAIEEVEQGRSAMLWAFVVAAVLIAAAAALVSLIWA
FT                   RRMTARLRGLTGALTALSERDLTVQAKVGGNDEIGEMGTALNTAVGELRELMSGISEAS
FT                   RRVEETSRNVSSTGAKLSDSASSAAEQTSNAAEAAAEVTRNVQTVAHSSTEMGSAIAEI
FT                   SRNTQAAAATAHDSVERTRQASDVIAELSAASAEITDVVRTISSIAEQTNLLALNATIE
FT                   AARAGDAGKGFAVVAGEVKDLAQETARATEDVSRRVEAINSGTTKAIESIAAITTAIDS
FT                   VNESQSAIAAAVEEQSATTDEVNRSISLASDHSSQIAVRLNQVSSTVESTRDAVRMSAD
FT                   AAEELSGTARQLTDLVGRFTL"
     MKRTRVTPLN LGLGHRLLAL SIGTVIATAG VLVVVGAWQS DKFSTAAAGN VAELIQTDTD        60
     HVTSGVSTLT RTAGEAIQES VNSSMNVANA ELAQRGGLRL DDSSTTSWKA VNQLTQEATD       120
     VTLPRAEVSG AWLGQNRDQS TPTPLVDDIR SMVSATVTVF QKMDDKGDLL RVATNVPNKA       180
     GERAIGTYIP ATAQDGTPNA VAKAINSGTS YRGVAKVVDT WYIAAYDPIK NANGDVIGAL       240
     YVGIPQDKAI AQLSQAISDT TVGANGRVTV YSTAAADKGR IIASTGGKDV GTTNADAADA       300
     NGVKYVDEIV SKATSLGEGQ VFNAVYQLPG LDGEPAAASP TNVVYYGPYQ WAIAVSSYGP       360
     DSAGAIEEVE QGRSAMLWAF VVAAVLIAAA AALVSLIWAR RMTARLRGLT GALTALSERD       420
     LTVQAKVGGN DEIGEMGTAL NTAVGELREL MSGISEASRR VEETSRNVSS TGAKLSDSAS       480
     SAAEQTSNAA EAAAEVTRNV QTVAHSSTEM GSAIAEISRN TQAAAATAHD SVERTRQASD       540
     VIAELSAASA EITDVVRTIS SIAEQTNLLA LNATIEAARA GDAGKGFAVV AGEVKDLAQE       600
     TARATEDVSR RVEAINSGTT KAIESIAAIT TAIDSVNESQ SAIAAAVEEQ SATTDEVNRS       660
     ISLASDHSSQ IAVRLNQVSS TVESTRDAVR MSADAAEELS GTARQLTDLV GRFTL            715
//

If you have problems or comments...

PBIL Back to PBIL home page