(data stored in ACNUC7421 zone)

EMBL: CP001630.PE196

CP001630.PE196       Location/Qualifiers
FT   CDS             complement(212696..214294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0199"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34170"
FT                   /db_xref="GOA:C6WF38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF38"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34170.1"
FT                   /translation="MAVKGRALAGAPVGVKILSGVAVAVLGMVVITGVAVGQMTSLRDG
FT                   QEQLNSEAVVPLAKFDEVRRAYLQTRVDALADEWVATTNGAEHEAFTKDIKAMDAALAD
FT                   LAKSAVTDVQRSSTAELQSAWSEYIKVVASDQFLQLARTGDRAGYVAARDSQVKPQAVR
FT                   IQNALDALVQDMTTSTAAQLERASDNYATGIWVLVGTLLAAIAVAVGLAVAATRAVTGP
FT                   LRRLSEVCDALAEGDLTKRTGLTGTDEVSRVGAALDGATAKTAEAISVLSDSARSVVAA
FT                   TGKLTDTAGRISGSSADTASRADAATEAAEHVSDGVQAIATGAEEMSASIQEIARNASH
FT                   AAQLGSHARSLTEQTGATMAQLGGSSAEIGNVIKVITSIAEQTNLLALNATIEAARAGD
FT                   AGKGFAVVANEVKDLAQETARATEEISNRVEAIQADSSNAVTAIATIADVINELDGVQA
FT                   TIAAAVEEQAATTAEMSRSVADASGRTTEITGNITGVAGSAAATSDGARTTTETIGELV
FT                   AVAGDLESVVDRFRY"
     MAVKGRALAG APVGVKILSG VAVAVLGMVV ITGVAVGQMT SLRDGQEQLN SEAVVPLAKF        60
     DEVRRAYLQT RVDALADEWV ATTNGAEHEA FTKDIKAMDA ALADLAKSAV TDVQRSSTAE       120
     LQSAWSEYIK VVASDQFLQL ARTGDRAGYV AARDSQVKPQ AVRIQNALDA LVQDMTTSTA       180
     AQLERASDNY ATGIWVLVGT LLAAIAVAVG LAVAATRAVT GPLRRLSEVC DALAEGDLTK       240
     RTGLTGTDEV SRVGAALDGA TAKTAEAISV LSDSARSVVA ATGKLTDTAG RISGSSADTA       300
     SRADAATEAA EHVSDGVQAI ATGAEEMSAS IQEIARNASH AAQLGSHARS LTEQTGATMA       360
     QLGGSSAEIG NVIKVITSIA EQTNLLALNA TIEAARAGDA GKGFAVVANE VKDLAQETAR       420
     ATEEISNRVE AIQADSSNAV TAIATIADVI NELDGVQATI AAAVEEQAAT TAEMSRSVAD       480
     ASGRTTEITG NITGVAGSAA ATSDGARTTT ETIGELVAVA GDLESVVDRF RY               532
//

If you have problems or comments...

PBIL Back to PBIL home page