(data stored in ACNUC7421 zone)

EMBL: CP001630.PE197

CP001630.PE197       Location/Qualifiers
FT   CDS             214464..215432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0200"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_pAT_447 DtxR/iron regulated lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34171"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF39"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34171.1"
FT                   /translation="MRLRPLVVLLALFATACGGSTDSGADTPSSASGDSAGVVTVDTRF
FT                   GPVQVEGTPKRVVALGWSDAEAALALGVQPVGVSDWMAFGGKGVGPWAESLYTETPQIL
FT                   GTMELDYEAVAALQPDLILNTRSDNDQAKHDKLSQIAPTIGAPKDVVTYGTTWQQQIEM
FT                   VGKALGKDAEAKKITEDLNAKFAANKKFDGKSAVVGSYFDGKFGAYVSGDARVDFLKAI
FT                   GFTPKAEVESLATGTFFVDVSAEQLNLFDADFTVIFPIGADTAPIKQHPVLSGIPSAKD
FT                   GRMLVMEDKTLVSAFSSGSTLGVAHALDKAVPQFQEILKVG"
     MRLRPLVVLL ALFATACGGS TDSGADTPSS ASGDSAGVVT VDTRFGPVQV EGTPKRVVAL        60
     GWSDAEAALA LGVQPVGVSD WMAFGGKGVG PWAESLYTET PQILGTMELD YEAVAALQPD       120
     LILNTRSDND QAKHDKLSQI APTIGAPKDV VTYGTTWQQQ IEMVGKALGK DAEAKKITED       180
     LNAKFAANKK FDGKSAVVGS YFDGKFGAYV SGDARVDFLK AIGFTPKAEV ESLATGTFFV       240
     DVSAEQLNLF DADFTVIFPI GADTAPIKQH PVLSGIPSAK DGRMLVMEDK TLVSAFSSGS       300
     TLGVAHALDK AVPQFQEILK VG                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page