(data stored in ACNUC7421 zone)

EMBL: CP001630.PE198

CP001630.PE198       Location/Qualifiers
FT   CDS             215613..217754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0201"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gbm:Gbem_0212 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34172"
FT                   /db_xref="GOA:C6WF40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF40"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACU34172.1"
FT                   /translation="MVRPVALALYRKYRPATFAEVIGQEHVTDPLRIALGAGRVNHAYL
FT                   FSGPRGCGKTSSARILARSLNCAKGPTPDPCGECNSCVGLAPNGPGSVDVVELDAASHG
FT                   GVDDTRELREKAFYAPAEAKYRVFIIDEAHMVTTQGFNALLKIVEEPPEHLIFIFATTE
FT                   PDKVLPTIRSRTHHYPFRLIPPVSMRALLERNCAAEGVAVEPSVFPLVIRAGGGSARDT
FT                   QSVMDQLLSGAGPEGVRYDRAIALLGVTDVALIDDVVEGLAAGDGSAVFGTVDRLVDAG
FT                   HDPRRFATDLLDRLRDLVLLCAVPDAGERGLVSAPEDVLAKMIPQAQNIGPATLTRYAE
FT                   VLHQGLTDMRGATAPRLLLELLCARMLLPSVSDAESAVLQRVERLEKHGVAAGGGNGGG
FT                   GAPAVESKFQRPSQRQAEPEPAPAQAAPQAVAPPVAATQIAAPPVVAPPAAAQPVAAPA
FT                   EPTPQPATPQQPAAQARPTAQAAPQQARFQRPSQSPPQPASAAAEPAAPAAAPASGAVD
FT                   AVEIRRRWPELLGVVKGASRSTEAMLTNATVAEVDGTSVTLTHTSGPLARRLAEQRNAE
FT                   VIAKAFGQVLGGSWQVRCVQGDAATAQRPQQQSRQARPAPARPSQAESAPAPGHGRQML
FT                   EKAMQAQANRSTGRAGDDIPLPPEPDEPDDPLPPEPVDEEEMFAEAARPGEPGEERLDP
FT                   EAVVLKLLADELGARPLKS"
     MVRPVALALY RKYRPATFAE VIGQEHVTDP LRIALGAGRV NHAYLFSGPR GCGKTSSARI        60
     LARSLNCAKG PTPDPCGECN SCVGLAPNGP GSVDVVELDA ASHGGVDDTR ELREKAFYAP       120
     AEAKYRVFII DEAHMVTTQG FNALLKIVEE PPEHLIFIFA TTEPDKVLPT IRSRTHHYPF       180
     RLIPPVSMRA LLERNCAAEG VAVEPSVFPL VIRAGGGSAR DTQSVMDQLL SGAGPEGVRY       240
     DRAIALLGVT DVALIDDVVE GLAAGDGSAV FGTVDRLVDA GHDPRRFATD LLDRLRDLVL       300
     LCAVPDAGER GLVSAPEDVL AKMIPQAQNI GPATLTRYAE VLHQGLTDMR GATAPRLLLE       360
     LLCARMLLPS VSDAESAVLQ RVERLEKHGV AAGGGNGGGG APAVESKFQR PSQRQAEPEP       420
     APAQAAPQAV APPVAATQIA APPVVAPPAA AQPVAAPAEP TPQPATPQQP AAQARPTAQA       480
     APQQARFQRP SQSPPQPASA AAEPAAPAAA PASGAVDAVE IRRRWPELLG VVKGASRSTE       540
     AMLTNATVAE VDGTSVTLTH TSGPLARRLA EQRNAEVIAK AFGQVLGGSW QVRCVQGDAA       600
     TAQRPQQQSR QARPAPARPS QAESAPAPGH GRQMLEKAMQ AQANRSTGRA GDDIPLPPEP       660
     DEPDDPLPPE PVDEEEMFAE AARPGEPGEE RLDPEAVVLK LLADELGARP LKS              713
//

If you have problems or comments...

PBIL Back to PBIL home page