(data stored in ACNUC7421 zone)

EMBL: CP001630.PE199

CP001630.PE199       Location/Qualifiers
FT   CDS             217802..218149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34173"
FT                   /db_xref="GOA:C6WF41"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF41"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34173.1"
FT                   /translation="MQPGQPNMQQILQQAQMMQQQLATAQQELTEAEVTGTAGGGLVRA
FT                   VVTGGGELKSLAIDPRAVDPEDVETLSDLVVAAVRDANRAAQELAAQKMGPLASGMGGL
FT                   DGLGGLGKLFG"
     MQPGQPNMQQ ILQQAQMMQQ QLATAQQELT EAEVTGTAGG GLVRAVVTGG GELKSLAIDP        60
     RAVDPEDVET LSDLVVAAVR DANRAAQELA AQKMGPLASG MGGLDGLGGL GKLFG            115
//

If you have problems or comments...

PBIL Back to PBIL home page