(data stored in ACNUC7421 zone)

EMBL: CP001630.PE2

CP001630.PE2         Location/Qualifiers
FT   CDS             2628..3764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: azc:AZC_1013 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33976"
FT                   /db_xref="GOA:C6WCF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU33976.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGAEDGSGD
FT                   ALTVSGFDYEVSAQCGVPATISDGGKALVSGKLLADITKALPNHPVEINVDGARMTITC
FT                   GSAKFSLPTMPVEDYPALPSMPQLAGELPGEVFGEAVAQVAVAAGKDDTLPMLTGVRLE
FT                   IADGKLVLVATDRFRLAMREFEWTPDETLGDVAVLVPAKTLNDSAKTLGASGAKIELSL
FT                   AANDGLLGLSGNGRRTTTRLLDADFPKYRQLLPSEHSAAAIISVDTLVQAIKRVSLVAE
FT                   RGTQVRLEFGDAGLKLSAGGDDEGSAEEELPVDYQGDPVTIAFNPTYLLEGLQAVRTPR
FT                   AHLSFTTPSRPALLKPVNEDGEVAEGYVYLLMPVRLPG"
     MKIRVERDGL ADAVAWVARS LPSRPPVPVL GGVLLDAGAE DGSGDALTVS GFDYEVSAQC        60
     GVPATISDGG KALVSGKLLA DITKALPNHP VEINVDGARM TITCGSAKFS LPTMPVEDYP       120
     ALPSMPQLAG ELPGEVFGEA VAQVAVAAGK DDTLPMLTGV RLEIADGKLV LVATDRFRLA       180
     MREFEWTPDE TLGDVAVLVP AKTLNDSAKT LGASGAKIEL SLAANDGLLG LSGNGRRTTT       240
     RLLDADFPKY RQLLPSEHSA AAIISVDTLV QAIKRVSLVA ERGTQVRLEF GDAGLKLSAG       300
     GDDEGSAEEE LPVDYQGDPV TIAFNPTYLL EGLQAVRTPR AHLSFTTPSR PALLKPVNED       360
     GEVAEGYVYL LMPVRLPG                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page