(data stored in ACNUC7421 zone)

EMBL: CP001630.PE20

CP001630.PE20        Location/Qualifiers
FT   CDS             20454..21095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0020"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   swi:Swit_3227 anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33994"
FT                   /db_xref="GOA:C6WCH3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH3"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU33994.1"
FT                   /translation="MRVLVVDNYDSFVYNLVQYLAQLGAECVVKRNDEVGPEDVAAAGG
FT                   VLVSPGPSTPHRAGRSMDVVRWCADSGVPVFGVCLGHQAIGAVWGATVDLAPELLHGKT
FT                   SVVHHEGAGVLAGLPRPFTATRYHSLTVLPETIPDEFEVTCRTEGGVVMGMRHRELPVE
FT                   GVQFHPESVLTDGGHRMLANWLAVCGYEVPEAVVGGLERNMRDLAAAARR"
     MRVLVVDNYD SFVYNLVQYL AQLGAECVVK RNDEVGPEDV AAAGGVLVSP GPSTPHRAGR        60
     SMDVVRWCAD SGVPVFGVCL GHQAIGAVWG ATVDLAPELL HGKTSVVHHE GAGVLAGLPR       120
     PFTATRYHSL TVLPETIPDE FEVTCRTEGG VVMGMRHREL PVEGVQFHPE SVLTDGGHRM       180
     LANWLAVCGY EVPEAVVGGL ERNMRDLAAA ARR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page