(data stored in ACNUC7421 zone)

EMBL: CP001630.PE200

CP001630.PE200       Location/Qualifiers
FT   CDS             218149..218742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0203"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: mxa:MXAN_1930 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34174"
FT                   /db_xref="GOA:C6WF42"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF42"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACU34174.1"
FT                   /translation="MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAAEPADIGRLQDA
FT                   LQKVKEGVVFCEVCGNVSAETTCRICRDPRRDLTLICVVEEPKDVLAVERTREFKGRYH
FT                   VLGGALDPLSGIGPDQLRIRQLLTRIGTDVSEIIIATDPNTEGEATATYLVRMLRDFPG
FT                   LSVTRLASGLPMGGDLEFADELTLGRALSGRRSL"
     MYEGPVQDLI DELGRLPGVG PKSAQRIAFH LLAAEPADIG RLQDALQKVK EGVVFCEVCG        60
     NVSAETTCRI CRDPRRDLTL ICVVEEPKDV LAVERTREFK GRYHVLGGAL DPLSGIGPDQ       120
     LRIRQLLTRI GTDVSEIIIA TDPNTEGEAT ATYLVRMLRD FPGLSVTRLA SGLPMGGDLE       180
     FADELTLGRA LSGRRSL                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page