(data stored in ACNUC7421 zone)

EMBL: CP001630.PE201

CP001630.PE201       Location/Qualifiers
FT   CDS             218756..219226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34175"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34175.1"
FT                   /translation="MLLIAVDGPSGSGKTTYARSLGGVVVPTDHFATWDDPVAWWPRLV
FT                   EGVLEPLWRDEPAHYQRVEWVGGEPKPGEWITFEPPEVLVLEGVSSARRAIADRLDLAV
FT                   WVEVPSESERLERAVARDGEDCRIHLRRWQDFERGWFAVDGTKARADRVILR"
     MLLIAVDGPS GSGKTTYARS LGGVVVPTDH FATWDDPVAW WPRLVEGVLE PLWRDEPAHY        60
     QRVEWVGGEP KPGEWITFEP PEVLVLEGVS SARRAIADRL DLAVWVEVPS ESERLERAVA       120
     RDGEDCRIHL RRWQDFERGW FAVDGTKARA DRVILR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page