(data stored in ACNUC7421 zone)

EMBL: CP001630.PE202

CP001630.PE202       Location/Qualifiers
FT   CDS             complement(225081..228347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0205"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; NB-ARC domain
FT                   protein; transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34176"
FT                   /db_xref="GOA:C6WF44"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF44"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34176.1"
FT                   /translation="MGEQLELGVLGPLRVVVGGRHVAVRAGRQRCLLASLLTRPGSPVS
FT                   VDELAEHVWGDRPPARARQTLHTYVMRLRRLLGPEVPIRTVPDGYLVDVPAASVDVARF
FT                   DGLLALGDREQAAGRLAEASSALAAALELWRGPALADVPSAVLHRDEAPRLTECGLHAR
FT                   ERRAEVDLALGRHAELVPELTALTAEHPLRERLWAQLVVALHRSGRRAEALAAYDRVSA
FT                   LLAEELGIDPGGELRRVHRAVLADEGGPAPGPEGAESGPEPVAPSQLPAGAGDFVGRSN
FT                   SVHLVETLLRRSHGVPVVTLSGQPGVGKTALAVHAAHRLRGDFPDGQLYVNLRGHAQGP
FT                   PLSAVDVLPRFLRAQGVAPESVPLDPDEQEALYRSRLTGRRVLVVLDDAASAEQIRPLL
FT                   PGSPGCAVLVTSRDALRGLAVSHAATNVRLDVLDDGEARALLSGVLGADVVGCQRAATG
FT                   ELVALCAHLPLALRIAAANVLSRPGTTVAEHVEELRAGNRLAALSVEGDERAAVQAAFD
FT                   LSYAALKPELAQLFRLLAVAPGDLTPDLAAALGGLPVPEARRRLHRLATVNLVDRPAPG
FT                   RYQFHDLLRDYAAQRLVAEDGEAGRDRVFRRLLDWSIRSVDAATEALKSTLVRHPRASD
FT                   VPGVEPKRFDSPAEALAWLDAERANLVALVSHAAARPPHEDGWQLADALRRYFYLAALP
FT                   VEWRAAAGAGLASARAARDPVGEAAMLSSLGVLYWSIGRHPVAVDHFLSALGVQERGGA
FT                   WPRARAQVLANLGAVYIDVGELERATEHLERALAITGEIGALQQQGITQLNLGGVYLQL
FT                   AELDRAAACFEGALDVGTRLGVWMTQADALHALAEVELLRGAPARAAGLFERSGELYGL
FT                   AGARSFAHIPHEGLAQAHLARGRYAEAIAEAGRALEFAQERENLKGRCDAKNVLGQALV
FT                   GAGRLVEGAGRHTEALGIAEEISYPWGIVAARRGLATAHHAAGRLVEAEEAARGALEGA
FT                   AAYRLRLPEGDVLVLLGRIELDLGEPDRALDTATRAAAAGAASGRRLLAAQADHLLGDL
FT                   RAAAGDSRAARALWDAAAAGYESAGAPEATSLRTLLRRVS"
     MGEQLELGVL GPLRVVVGGR HVAVRAGRQR CLLASLLTRP GSPVSVDELA EHVWGDRPPA        60
     RARQTLHTYV MRLRRLLGPE VPIRTVPDGY LVDVPAASVD VARFDGLLAL GDREQAAGRL       120
     AEASSALAAA LELWRGPALA DVPSAVLHRD EAPRLTECGL HARERRAEVD LALGRHAELV       180
     PELTALTAEH PLRERLWAQL VVALHRSGRR AEALAAYDRV SALLAEELGI DPGGELRRVH       240
     RAVLADEGGP APGPEGAESG PEPVAPSQLP AGAGDFVGRS NSVHLVETLL RRSHGVPVVT       300
     LSGQPGVGKT ALAVHAAHRL RGDFPDGQLY VNLRGHAQGP PLSAVDVLPR FLRAQGVAPE       360
     SVPLDPDEQE ALYRSRLTGR RVLVVLDDAA SAEQIRPLLP GSPGCAVLVT SRDALRGLAV       420
     SHAATNVRLD VLDDGEARAL LSGVLGADVV GCQRAATGEL VALCAHLPLA LRIAAANVLS       480
     RPGTTVAEHV EELRAGNRLA ALSVEGDERA AVQAAFDLSY AALKPELAQL FRLLAVAPGD       540
     LTPDLAAALG GLPVPEARRR LHRLATVNLV DRPAPGRYQF HDLLRDYAAQ RLVAEDGEAG       600
     RDRVFRRLLD WSIRSVDAAT EALKSTLVRH PRASDVPGVE PKRFDSPAEA LAWLDAERAN       660
     LVALVSHAAA RPPHEDGWQL ADALRRYFYL AALPVEWRAA AGAGLASARA ARDPVGEAAM       720
     LSSLGVLYWS IGRHPVAVDH FLSALGVQER GGAWPRARAQ VLANLGAVYI DVGELERATE       780
     HLERALAITG EIGALQQQGI TQLNLGGVYL QLAELDRAAA CFEGALDVGT RLGVWMTQAD       840
     ALHALAEVEL LRGAPARAAG LFERSGELYG LAGARSFAHI PHEGLAQAHL ARGRYAEAIA       900
     EAGRALEFAQ ERENLKGRCD AKNVLGQALV GAGRLVEGAG RHTEALGIAE EISYPWGIVA       960
     ARRGLATAHH AAGRLVEAEE AARGALEGAA AYRLRLPEGD VLVLLGRIEL DLGEPDRALD      1020
     TATRAAAAGA ASGRRLLAAQ ADHLLGDLRA AAGDSRAARA LWDAAAAGYE SAGAPEATSL      1080
     RTLLRRVS                                                               1088
//

If you have problems or comments...

PBIL Back to PBIL home page