(data stored in ACNUC7421 zone)

EMBL: CP001630.PE203

CP001630.PE203       Location/Qualifiers
FT   CDS             228577..230262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0206"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hap:HAPS_0936 periplasmic dipeptide transport protein
FT                   DppA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34177"
FT                   /db_xref="GOA:C6WF45"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF45"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACU34177.1"
FT                   /translation="MVHSRSAQRRWVAAIGLTSAAALVLTSCVQSERSQDSGTGGAAGG
FT                   TFTFGAAGAPKLFDPMFATDGETFRVARQMFDGLTTFKPGTAEPAPSLAKEWSSTPDGL
FT                   TWTFKLETGVKFHDGSDFNAEAVCFNFDRWYNLKGDAQSDAVSQYYVDNFGGFSDKPET
FT                   SLYKSCAAEGADTAVVTLTKTTSKFPDILGLPSFSMQSPKALKEFNADDVKAQGDSFVF
FT                   PAYANEHPTGTGPFKFGKYDKANNVVELVRNDDYWGEKTKLDKLVFRIIPDETARKQAL
FT                   QSGDIDGFDFPNAADWDSLKSGGFNVEVRPAFNVFYVGINQKRNPKLQDLKVRQALLHA
FT                   INREQLVKSQLPEGAEVATQFIPKTVGGYADDVQKYEYSVDKAKSLLAEAGASDLTLKF
FT                   YWPSEVSRPYMPSPKDLYGAIAADLQAAGIKVEAVTKPWNGGYLTDVDQGAQADLFLLG
FT                   WTGDTGSADNWVGTFFGNPANRFNTGASAWGADLSAQLKTADAEPDRTKRYDLYKEINR
FT                   KIMAEYVPALPISHSPPALVVKNTVKGITPSPLTDEKFVDVTVN"
     MVHSRSAQRR WVAAIGLTSA AALVLTSCVQ SERSQDSGTG GAAGGTFTFG AAGAPKLFDP        60
     MFATDGETFR VARQMFDGLT TFKPGTAEPA PSLAKEWSST PDGLTWTFKL ETGVKFHDGS       120
     DFNAEAVCFN FDRWYNLKGD AQSDAVSQYY VDNFGGFSDK PETSLYKSCA AEGADTAVVT       180
     LTKTTSKFPD ILGLPSFSMQ SPKALKEFNA DDVKAQGDSF VFPAYANEHP TGTGPFKFGK       240
     YDKANNVVEL VRNDDYWGEK TKLDKLVFRI IPDETARKQA LQSGDIDGFD FPNAADWDSL       300
     KSGGFNVEVR PAFNVFYVGI NQKRNPKLQD LKVRQALLHA INREQLVKSQ LPEGAEVATQ       360
     FIPKTVGGYA DDVQKYEYSV DKAKSLLAEA GASDLTLKFY WPSEVSRPYM PSPKDLYGAI       420
     AADLQAAGIK VEAVTKPWNG GYLTDVDQGA QADLFLLGWT GDTGSADNWV GTFFGNPANR       480
     FNTGASAWGA DLSAQLKTAD AEPDRTKRYD LYKEINRKIM AEYVPALPIS HSPPALVVKN       540
     TVKGITPSPL TDEKFVDVTV N                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page