(data stored in ACNUC7421 zone)

EMBL: CP001630.PE204

CP001630.PE204       Location/Qualifiers
FT   CDS             230308..231318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pde:Pden_1670
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34178"
FT                   /db_xref="GOA:C6WF46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF46"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34178.1"
FT                   /translation="MLRYTIRRLIQLVVVVLVLSLLVFSWLRALPGGPASALLGERGTE
FT                   ESRAALSKQLGLDQPIFVQYFKFLGRALTGDFGNSTGVQPGDAVVDIFLQRFPATIELS
FT                   AFAMLIAIALGIPLGYLAARKRGGLFDNLSVGGSLIGVAVPVFFLAYLLKYVFASQLGW
FT                   LPSAGRQSAGLDATRVTGFFVLDGFLTQEWDAALNALTHLVLPACALATIPFAVIFRIT
FT                   RAAVLDVLNEDYVRTAESKGLLGSVIRRRHILRNAMLPVVTTIGLQIGALLAGAVLTEK
FT                   VFAFPGVGEALAIGFERRDYPVLQMFILVAAMIYVLVNLLVDLSYALIDPRIRAR"
     MLRYTIRRLI QLVVVVLVLS LLVFSWLRAL PGGPASALLG ERGTEESRAA LSKQLGLDQP        60
     IFVQYFKFLG RALTGDFGNS TGVQPGDAVV DIFLQRFPAT IELSAFAMLI AIALGIPLGY       120
     LAARKRGGLF DNLSVGGSLI GVAVPVFFLA YLLKYVFASQ LGWLPSAGRQ SAGLDATRVT       180
     GFFVLDGFLT QEWDAALNAL THLVLPACAL ATIPFAVIFR ITRAAVLDVL NEDYVRTAES       240
     KGLLGSVIRR RHILRNAMLP VVTTIGLQIG ALLAGAVLTE KVFAFPGVGE ALAIGFERRD       300
     YPVLQMFILV AAMIYVLVNL LVDLSYALID PRIRAR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page