(data stored in ACNUC7421 zone)

EMBL: CP001630.PE205

CP001630.PE205       Location/Qualifiers
FT   CDS             231325..232257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0208"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3642 dipeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34179"
FT                   /db_xref="GOA:C6WF47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF47"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34179.1"
FT                   /translation="MTPTTKKERIDALAESSASDSGVSLAASAWKRLRRSPVFLLGAAI
FT                   IALFLVVAAIAPWLAPHDPAARDLIDQVIKARNQIPGPQEGYPLGGDLVGRDLLSRLLV
FT                   GAQQTLLVGVFATLIGLAGGMVLGILAGAFGGWVDSLVMRVVDVMLSIPQLLLAFGIGA
FT                   LFARPSLLTVILAVSIVQIPVFARLLRGSMLAQRSSDHVLAATALGVKPGPIVFRHMLP
FT                   NSLGPVIVQSTLVLATSIIDAAALSFLGLGNPDDTIPEWGQMLGSAQTVIDSHPHLAFW
FT                   PAGCIIVIALGFTLVGESLRDALDPKNRR"
     MTPTTKKERI DALAESSASD SGVSLAASAW KRLRRSPVFL LGAAIIALFL VVAAIAPWLA        60
     PHDPAARDLI DQVIKARNQI PGPQEGYPLG GDLVGRDLLS RLLVGAQQTL LVGVFATLIG       120
     LAGGMVLGIL AGAFGGWVDS LVMRVVDVML SIPQLLLAFG IGALFARPSL LTVILAVSIV       180
     QIPVFARLLR GSMLAQRSSD HVLAATALGV KPGPIVFRHM LPNSLGPVIV QSTLVLATSI       240
     IDAAALSFLG LGNPDDTIPE WGQMLGSAQT VIDSHPHLAF WPAGCIIVIA LGFTLVGESL       300
     RDALDPKNRR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page