(data stored in ACNUC7421 zone)

EMBL: CP001630.PE206

CP001630.PE206       Location/Qualifiers
FT   CDS             232263..233258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0209"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:bll2870 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34180"
FT                   /db_xref="GOA:C6WF48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF48"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34180.1"
FT                   /translation="MALLEVRDLTVVFERKGEQPFTAVDGVSFDVEPGQTVGLVGESGC
FT                   GKSVTSLAIMGLLPKRGARITGSVGYEGTDLLKLSDRQMRDRRGRDLGMVFQDPLSSLN
FT                   PVIPIGLQVTEVLERHRGMARKQAMVEAADLLDKVGIPDPTRRLSEYPHQLSGGMRQRA
FT                   LIAIALACRPRLLIADEPTTALDVTIQAQILALLKELVQDTGTALVMITHDLGVVAGLC
FT                   DEVNVLYGGRVVEKARRHELFGQPRHPYTHGLLASIPRLDAPRGERLVPIKGSVADNIP
FT                   WEGGCAFAPRCPNALDVCVTTTPEQEDLGGGRLLRCHNPVRPEVAEEVGA"
     MALLEVRDLT VVFERKGEQP FTAVDGVSFD VEPGQTVGLV GESGCGKSVT SLAIMGLLPK        60
     RGARITGSVG YEGTDLLKLS DRQMRDRRGR DLGMVFQDPL SSLNPVIPIG LQVTEVLERH       120
     RGMARKQAMV EAADLLDKVG IPDPTRRLSE YPHQLSGGMR QRALIAIALA CRPRLLIADE       180
     PTTALDVTIQ AQILALLKEL VQDTGTALVM ITHDLGVVAG LCDEVNVLYG GRVVEKARRH       240
     ELFGQPRHPY THGLLASIPR LDAPRGERLV PIKGSVADNI PWEGGCAFAP RCPNALDVCV       300
     TTTPEQEDLG GGRLLRCHNP VRPEVAEEVG A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page