(data stored in ACNUC7421 zone)

EMBL: CP001630.PE207

CP001630.PE207       Location/Qualifiers
FT   CDS             233255..234397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0210"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34181"
FT                   /db_xref="GOA:C6WF49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF49"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34181.1"
FT                   /translation="MTAAEPVQAERAPEGDALISIEGIQVHFPIKRGVFLDRTVGHVYA
FT                   VDGVDLSIRKGETYGLVGESGCGKSTLGRAVLRLTEPTGGRVVFDGTDLSTLKGEALRT
FT                   MRQRMQMVFQDPMSSLDPRQSVESILVEGLRAHGLDKGKEATGKRLRELLAAVGLPSTS
FT                   LRKYPHEFSGGQRQRIGIARALAVEPDLIIADEPVSALDVSVQAQVVNLLEELQEKLGL
FT                   TYLVIAHDLAVVRHIADRVGVMYLGGIVEEASSDGLYAEPLHPYTRALLSAIPVPDPVV
FT                   EDRRERILLKGDLPSPANPPTGCRFHTRCPWRQATRCDTERPALREVLPGHRVACHWAE
FT                   DIRSGAIKPHEVEAVLVEEDGISPDVPLVGPASVTEVLNP"
     MTAAEPVQAE RAPEGDALIS IEGIQVHFPI KRGVFLDRTV GHVYAVDGVD LSIRKGETYG        60
     LVGESGCGKS TLGRAVLRLT EPTGGRVVFD GTDLSTLKGE ALRTMRQRMQ MVFQDPMSSL       120
     DPRQSVESIL VEGLRAHGLD KGKEATGKRL RELLAAVGLP STSLRKYPHE FSGGQRQRIG       180
     IARALAVEPD LIIADEPVSA LDVSVQAQVV NLLEELQEKL GLTYLVIAHD LAVVRHIADR       240
     VGVMYLGGIV EEASSDGLYA EPLHPYTRAL LSAIPVPDPV VEDRRERILL KGDLPSPANP       300
     PTGCRFHTRC PWRQATRCDT ERPALREVLP GHRVACHWAE DIRSGAIKPH EVEAVLVEED       360
     GISPDVPLVG PASVTEVLNP                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page