(data stored in ACNUC7421 zone)

EMBL: CP001630.PE208

CP001630.PE208       Location/Qualifiers
FT   CDS             234560..236698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0211"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: xom:XOO_3262 type I
FT                   restriction system adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34182"
FT                   /db_xref="GOA:C6WF50"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF50"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACU34182.1"
FT                   /translation="MGLQPKLLTAGGIAELLSVRASAISNWRKRHRDFPRPREAAGQEL
FT                   FDAAEVGRWLAGRRVPRTALRRDEAEGATYQHRFLRGVGRPAPVVERGPVAPGRAPALL
FT                   AHAEPLRVASGLGVDFPLGLLRLRVADPAGWGALVAAARGGAGARVRGLLVDARLPGAD
FT                   VEAGGALPAAVLAAVLAAVLAADAAEEPARVADALLSRPGRDAGHRTPPLARCLVELVD
FT                   PRPGETVHDPCCGDGRLLVAVAGHLAPESPGAGALSGRAADEVSSRVCAALLGIRGMSA
FT                   DLRAHGDGFRCELFDVVVAHPPVTLAPPGGEGPPLGEPSARGAGLAWVQHALRELAPGG
FT                   RAALLVPGSTASGQAGRDVAVRRALVEAGVVECVVALPGRSSRAVVWVLRAPGAGPVDP
FT                   EVLFVDAAGGGEPGGRVVDDAVVDRVVGEHRRRAERGGRRFAGQEGFSRSAARAEIARN
FT                   DFRLAPAGYVARPAAASAPLEHLLAEVDALRAELSGLRGAVAAREAEGERAFAAALAAT
FT                   GGVPRAEVPLGRIAEVAAGPGTMARGDGVPVVLPRNIGGGRVDRGAHDLAPARGDRYAL
FT                   RAGDVVCARTGTLGRGRSGGTGRYGVVGADQDGWLLGPGCLRLRPGTGVVPGYLAHFLN
FT                   SPEGAAGLERLLSGGAVPHVTTRAMGELVVRLPPTAAQTTIAAALDAADARLALHRRVE
FT                   DAERELRELTFAAPTHAR"
     MGLQPKLLTA GGIAELLSVR ASAISNWRKR HRDFPRPREA AGQELFDAAE VGRWLAGRRV        60
     PRTALRRDEA EGATYQHRFL RGVGRPAPVV ERGPVAPGRA PALLAHAEPL RVASGLGVDF       120
     PLGLLRLRVA DPAGWGALVA AARGGAGARV RGLLVDARLP GADVEAGGAL PAAVLAAVLA       180
     AVLAADAAEE PARVADALLS RPGRDAGHRT PPLARCLVEL VDPRPGETVH DPCCGDGRLL       240
     VAVAGHLAPE SPGAGALSGR AADEVSSRVC AALLGIRGMS ADLRAHGDGF RCELFDVVVA       300
     HPPVTLAPPG GEGPPLGEPS ARGAGLAWVQ HALRELAPGG RAALLVPGST ASGQAGRDVA       360
     VRRALVEAGV VECVVALPGR SSRAVVWVLR APGAGPVDPE VLFVDAAGGG EPGGRVVDDA       420
     VVDRVVGEHR RRAERGGRRF AGQEGFSRSA ARAEIARNDF RLAPAGYVAR PAAASAPLEH       480
     LLAEVDALRA ELSGLRGAVA AREAEGERAF AAALAATGGV PRAEVPLGRI AEVAAGPGTM       540
     ARGDGVPVVL PRNIGGGRVD RGAHDLAPAR GDRYALRAGD VVCARTGTLG RGRSGGTGRY       600
     GVVGADQDGW LLGPGCLRLR PGTGVVPGYL AHFLNSPEGA AGLERLLSGG AVPHVTTRAM       660
     GELVVRLPPT AAQTTIAAAL DAADARLALH RRVEDAEREL RELTFAAPTH AR               712
//

If you have problems or comments...

PBIL Back to PBIL home page