(data stored in ACNUC7421 zone)

EMBL: CP001630.PE209

CP001630.PE209       Location/Qualifiers
FT   CDS             237187..237762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0212"
FT                   /product="putative membrane-associated protein"
FT                   /note="KEGG: pol:Bpro_3150 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34183"
FT                   /db_xref="GOA:C6WF51"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF51"
FT                   /inference="protein motif:COG:COG0586"
FT                   /protein_id="ACU34183.1"
FT                   /translation="MTPLLVLFAVAAVPLAPTEAVLIACGVLAASGELPLGAVIAVAAA
FT                   GCTVADLVNLAIGRALGGRALARFERRAGSRAVLDWTRARLAGRGEAVLVAVRFVPGGG
FT                   VVAALLVGALRWRALRFLPIAAVGSLLWSAYVGLLGYFGGTLLDDPVLALIASLAVATL
FT                   IGVPAGVAVRAAQRREALRDGGPEPLAV"
     MTPLLVLFAV AAVPLAPTEA VLIACGVLAA SGELPLGAVI AVAAAGCTVA DLVNLAIGRA        60
     LGGRALARFE RRAGSRAVLD WTRARLAGRG EAVLVAVRFV PGGGVVAALL VGALRWRALR       120
     FLPIAAVGSL LWSAYVGLLG YFGGTLLDDP VLALIASLAV ATLIGVPAGV AVRAAQRREA       180
     LRDGGPEPLA V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page