(data stored in ACNUC7421 zone)

EMBL: CP001630.PE21

CP001630.PE21        Location/Qualifiers
FT   CDS             complement(21196..23241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0021"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33995"
FT                   /db_xref="GOA:C6WCH4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33995.1"
FT                   /translation="MSTPRLLSNRYELGETLGYGGMSEVHKGKDVRLSRDVAIKVLRAD
FT                   LARDAQFQERFRREAQNSAALNHPAIVAVYDTGETETQYGPLPYIVMEYVDGRTLRDIV
FT                   KTQGPLSNKRAMEVMADVSAALDFSHRHGIVHRDVKPANVMITRSGAVKVMDFGIARAV
FT                   HDGQAAVTQTAAVIGTAQYLSPEQAKGEAVDGRSDVYASGCVLFELLTGEPPFTGDSPV
FT                   AVAYQHVREEPKSPSSLNPKVSPALDSIVLKAMAKGPANRYQSAAELRADLVRVLSGQR
FT                   PSAPVVMTSEERTALLDQQSASAPTRSEAVQTTSGGGRHRQSVVRERERERDREDTGNY
FT                   SAALEEERERLAARRRMWMITIVVLLCAGVLALAIWITTSLLGDNESSGGDPKQVTVPT
FT                   LIGKSTSEARGALSDAGLEINLQLVPCQPGSQPKCDPAKDVDRVLETSPTSGKSVDRNS
FT                   KITVMVGTNPDDVEVPDLTGLSVADAQAKLGEDWKLDTNQERVETSDPAKVDKVVEQNP
FT                   MHGTKAPKGTTITIKIGKEPEAVTLPNVIGVQEDDARSSLEQSGFKVQVKQVDSATDAG
FT                   QVIAQDPGAGRVEKGSTVTLSVSKGNMVSMPDLRGMTENEAKAALRQFQWNGDLQTTKT
FT                   PVSDLSQDRKVQSQQTSPGSAITKAQRITVVIGEFRPGASSTPPSN"
     MSTPRLLSNR YELGETLGYG GMSEVHKGKD VRLSRDVAIK VLRADLARDA QFQERFRREA        60
     QNSAALNHPA IVAVYDTGET ETQYGPLPYI VMEYVDGRTL RDIVKTQGPL SNKRAMEVMA       120
     DVSAALDFSH RHGIVHRDVK PANVMITRSG AVKVMDFGIA RAVHDGQAAV TQTAAVIGTA       180
     QYLSPEQAKG EAVDGRSDVY ASGCVLFELL TGEPPFTGDS PVAVAYQHVR EEPKSPSSLN       240
     PKVSPALDSI VLKAMAKGPA NRYQSAAELR ADLVRVLSGQ RPSAPVVMTS EERTALLDQQ       300
     SASAPTRSEA VQTTSGGGRH RQSVVRERER ERDREDTGNY SAALEEERER LAARRRMWMI       360
     TIVVLLCAGV LALAIWITTS LLGDNESSGG DPKQVTVPTL IGKSTSEARG ALSDAGLEIN       420
     LQLVPCQPGS QPKCDPAKDV DRVLETSPTS GKSVDRNSKI TVMVGTNPDD VEVPDLTGLS       480
     VADAQAKLGE DWKLDTNQER VETSDPAKVD KVVEQNPMHG TKAPKGTTIT IKIGKEPEAV       540
     TLPNVIGVQE DDARSSLEQS GFKVQVKQVD SATDAGQVIA QDPGAGRVEK GSTVTLSVSK       600
     GNMVSMPDLR GMTENEAKAA LRQFQWNGDL QTTKTPVSDL SQDRKVQSQQ TSPGSAITKA       660
     QRITVVIGEF RPGASSTPPS N                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page