(data stored in ACNUC7421 zone)

EMBL: CP001630.PE210

CP001630.PE210       Location/Qualifiers
FT   CDS             complement(237857..239653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0213"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: csa:Csal_2535 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34184"
FT                   /db_xref="GOA:C6WF52"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF52"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ACU34184.1"
FT                   /translation="MSTISPDAYSTGTSRIRPPARPAPEGQPAWNPQRGTSMPVHRYRP
FT                   FHELVETVDLPDRTWPAKRITQAPQWCAVDLRDGNQALIDPMSPARKRKMFDLLVRMGY
FT                   KEIEVGFPAASQTDFDFVREIIEDGAVPDDVTIQVLTQCRPELITRTYESLRGAHKAIV
FT                   HFYNSTSVLQRKVVFRADRDRIKAIATDAARFALEEAKKYPETEFRYEYSPESYTGTEL
FT                   SYALEVCDAVSEIIAPTPELPMVINLPATVEMATPNVYADSIEWMSRHLARRDSIVLSL
FT                   HPHNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGMNMFSQGVDPQIDFS
FT                   DIDEVRRTVEYCNQLPVHERHPYGGDLVFTAFSGSHQDAIKKGFEALEADAKDADKHVD
FT                   EYPWEVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYVMKSEHHLDLPRRLQVEFSRVI
FT                   QEVTDTQGGEVGPKEIWDAFADEYLQGVAPLRLLKHELSSDGTGSESIKTVLVVDGETQ
FT                   DVTGTGNGPIAAFVDALASVGYDVRVLDYSEHALSSGDDARAASYVECSVGDRVLWGVG
FT                   VDSSTVAASLRALVSAVNRANR"
     MSTISPDAYS TGTSRIRPPA RPAPEGQPAW NPQRGTSMPV HRYRPFHELV ETVDLPDRTW        60
     PAKRITQAPQ WCAVDLRDGN QALIDPMSPA RKRKMFDLLV RMGYKEIEVG FPAASQTDFD       120
     FVREIIEDGA VPDDVTIQVL TQCRPELITR TYESLRGAHK AIVHFYNSTS VLQRKVVFRA       180
     DRDRIKAIAT DAARFALEEA KKYPETEFRY EYSPESYTGT ELSYALEVCD AVSEIIAPTP       240
     ELPMVINLPA TVEMATPNVY ADSIEWMSRH LARRDSIVLS LHPHNDRGTG VAAAELGYLA       300
     GADRIEGCLF GNGERTGNVC LVTLGMNMFS QGVDPQIDFS DIDEVRRTVE YCNQLPVHER       360
     HPYGGDLVFT AFSGSHQDAI KKGFEALEAD AKDADKHVDE YPWEVPYLPI DPKDVGRNYE       420
     AVIRVNSQSG KGGVAYVMKS EHHLDLPRRL QVEFSRVIQE VTDTQGGEVG PKEIWDAFAD       480
     EYLQGVAPLR LLKHELSSDG TGSESIKTVL VVDGETQDVT GTGNGPIAAF VDALASVGYD       540
     VRVLDYSEHA LSSGDDARAA SYVECSVGDR VLWGVGVDSS TVAASLRALV SAVNRANR         598
//

If you have problems or comments...

PBIL Back to PBIL home page